|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 9)| Asymmetric/Biological Unit (4, 9) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3OBH) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3OBH) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3OBH) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3OBH) |
Exons (0, 0)| (no "Exon" information available for 3OBH) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:66 aligned with A0A0H2UPA7_S | A0A0H2UPA7 from UniProtKB/TrEMBL Length:79 Alignment length:66 21 31 41 51 61 71 A0A0H2UPA7_S 12 FTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKMGKGITLSNEEFQTMVDAFK 77 SCOP domains ------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 3obh A 12 FTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKmGKGITLSNEEFQTmVDAFK 77 21 31 41 51 | 61 71| 58-MSE 72-MSE Chain B from PDB Type:PROTEIN Length:67 aligned with A0A0H2UPA7_S | A0A0H2UPA7 from UniProtKB/TrEMBL Length:79 Alignment length:67 19 29 39 49 59 69 A0A0H2UPA7_S 10 AEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKMGKGITLSNEEFQTMVDAF 76 SCOP domains ------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 3obh B 10 AEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKmGKGITLSNEEFQTmVDAF 76 19 29 39 49 59 69 | 58-MSE 72-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3OBH) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3OBH) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3OBH) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3OBH)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|