Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  SUBSTRATE INDUCED REMODELING OF THE ACTIVE SITE REGULATES HTRA1 ACTIVITY
 
Authors :  L. Truebestein, A. Tennstaedt, P. Hauske, T. Krojer, M. Kaiser, T. Clau M. Ehrmann
Date :  07 Jul 10  (Deposition) - 23 Feb 11  (Release) - 30 Mar 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.75
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (3x)
Keywords :  Serine Protease, Degp, Htra, Protease, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Truebestein, A. Tennstaedt, T. Monig, T. Krojer, F. Canellas, M. Kaiser, T. Clausen, M. Ehrmann
Substrate-Induced Remodeling Of The Active Site Regulates Human Htra1 Activity.
Nat. Struct. Mol. Biol. V. 18 386 2011
PubMed-ID: 21297635  |  Reference-DOI: 10.1038/NSMB.2013

(-) Compounds

Molecule 1 - SERINE PROTEASE HTRA1
    ChainsA
    EC Number3.4.21.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21D
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentPROTEASE AND PDZ DOMAIN (UNP RESIDUE 158-480)
    GeneHTRA1, HTRA, PRSS11
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymL56, SERINE PROTEASE 11

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (3x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3NUM)

(-) Sites  (0, 0)

(no "Site" information available for 3NUM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3NUM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3NUM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (6, 6)

Asymmetric Unit (6, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076376R166LHTRA1_HUMANDisease (CADASIL2)864622781AR166L
2UniProtVAR_076377A173PHTRA1_HUMANDisease (CADASIL2)  ---AA173P
3UniProtVAR_063148A252THTRA1_HUMANDisease (CARASIL)113993968AA252T
4UniProtVAR_076378S284GHTRA1_HUMANDisease (CADASIL2)  ---AS284G
5UniProtVAR_076379S284RHTRA1_HUMANDisease (CADASIL2)864622782AS284R
6UniProtVAR_063149V297MHTRA1_HUMANDisease (CARASIL)113993969AV297M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (6, 18)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076376R166LHTRA1_HUMANDisease (CADASIL2)864622781AR166L
2UniProtVAR_076377A173PHTRA1_HUMANDisease (CADASIL2)  ---AA173P
3UniProtVAR_063148A252THTRA1_HUMANDisease (CARASIL)113993968AA252T
4UniProtVAR_076378S284GHTRA1_HUMANDisease (CADASIL2)  ---AS284G
5UniProtVAR_076379S284RHTRA1_HUMANDisease (CADASIL2)864622782AS284R
6UniProtVAR_063149V297MHTRA1_HUMANDisease (CARASIL)113993969AV297M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PDZPS50106 PDZ domain profile.HTRA1_HUMAN365-454  1A:365-369
Biological Unit 1 (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PDZPS50106 PDZ domain profile.HTRA1_HUMAN365-454  3A:365-369

(-) Exons   (5, 5)

Asymmetric Unit (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003689841aENSE00001448527chr10:124221041-124221640600HTRA1_HUMAN1-1581580--
1.2ENST000003689842ENSE00001727698chr10:124248418-124248517100HTRA1_HUMAN158-191341A:161-19131
1.3ENST000003689843ENSE00001656483chr10:124248938-124249142205HTRA1_HUMAN191-259691A:191-25969
1.4ENST000003689844ENSE00001691312chr10:124266207-124266401195HTRA1_HUMAN260-324651A:260-324 (gaps)65
1.5ENST000003689845ENSE00001099158chr10:124266886-12426691833HTRA1_HUMAN325-335111A:325-33511
1.6ENST000003689846ENSE00001099160chr10:124268172-124268286115HTRA1_HUMAN336-374391A:336-36934
1.7ENST000003689847ENSE00001099153chr10:124269612-12426966958HTRA1_HUMAN374-393200--
1.8ENST000003689848ENSE00001099157chr10:124271486-12427158196HTRA1_HUMAN393-425330--
1.9bENST000003689849bENSE00001608082chr10:124273707-124274424718HTRA1_HUMAN425-480560--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:190
 aligned with HTRA1_HUMAN | Q92743 from UniProtKB/Swiss-Prot  Length:480

    Alignment length:209
                                   170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360         
          HTRA1_HUMAN   161 DPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHD 369
               SCOP domains d3numa_ A: automated matches                                                                                                                                                                                      SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------Trypsin_2-3numA01 A:204-342                                                                                                                --------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhh..eeeeeeeee......eeeeeeeeeeeee...eeee.........eeeeee....eeeeeeeeee....eeeee......................eeeee..-----..eeeeeeee.--------------..eee...........eeee....eeeeeeeeee..eeeeeehhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -----L------P------------------------------------------------------------------------------T-------------------------------G------------M------------------------------------------------------------------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------R------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PDZ   PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:161-191       --------------------------------------------------------------------Exon 1.4  PDB: A:260-324 (gaps) UniProt: 260-324                 Exon 1.5   Exon 1.6  PDB: A:336-369           Transcript 1 (1)
           Transcript 1 (2) ------------------------------Exon 1.3  PDB: A:191-259 UniProt: 191-259                            -------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3num A 161 DPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGS-----NTVTTGIVSTT--------------DYIQTDAIINYGNAGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHD 369
                                   170       180       190       200       210       220       230       240       250       260       270       280   |   290       300         -    |  320       330       340       350       360         
                                                                                                                                                     284   290       300            315                                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3NUM)

(-) Pfam Domains  (1, 1)

Asymmetric Unit

(-) Gene Ontology  (24, 24)

Asymmetric Unit(hide GO term definitions)
Chain A   (HTRA1_HUMAN | Q92743)
molecular function
    GO:0019838    growth factor binding    Interacting selectively and non-covalently with any growth factor, proteins or polypeptides that stimulate a cell or organism to grow or proliferate.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0005520    insulin-like growth factor binding    Interacting selectively and non-covalently with an insulin-like growth factor, any member of a group of polypeptides that are structurally homologous to insulin and share many of its biological activities, but are immunologically distinct from it.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0060718    chorionic trophoblast cell differentiation    The process in which relatively unspecialized cells of the ectoplacental cone acquire specialized structural and/or functional features that characterize chorionic trophoblasts. These cells will migrate towards the spongiotrophoblast layer and give rise to syncytiotrophoblasts of the labyrinthine layer.
    GO:0097187    dentinogenesis    The process whose specific outcome is the formation of dentin, the mineralized tissue that constitutes the major bulk of teeth. Dentin may be one of three types: primary dentin, secondary dentin, and tertiary dentin.
    GO:0022617    extracellular matrix disassembly    A process that results in the breakdown of the extracellular matrix.
    GO:0030514    negative regulation of BMP signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the BMP signaling pathway.
    GO:0050687    negative regulation of defense response to virus    Any process that stops, prevents or reduces the rate or extent of antiviral mechanisms, thereby facilitating viral replication.
    GO:0030512    negative regulation of transforming growth factor beta receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
    GO:0001890    placenta development    The process whose specific outcome is the progression of the placenta over time, from its formation to the mature structure. The placenta is an organ of metabolic interchange between fetus and mother, partly of embryonic origin and partly of maternal origin.
    GO:0050679    positive regulation of epithelial cell proliferation    Any process that activates or increases the rate or extent of epithelial cell proliferation.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0001558    regulation of cell growth    Any process that modulates the frequency, rate, extent or direction of cell growth.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3num)
 
  Sites
(no "Sites" information available for 3num)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3num)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3num
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HTRA1_HUMAN | Q92743
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  600142
    Disease InformationOMIM
  616779
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HTRA1_HUMAN | Q92743
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HTRA1_HUMAN | Q927432joa 2ytw 3nwu 3nzi 3tjn 3tjo 3tjq

(-) Related Entries Specified in the PDB File

3nwu