|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3NSO) |
(no "Site" information available for 3NSO) |
Asymmetric/Biological Unit
|
(no "Cis Peptide Bond" information available for 3NSO) |
Asymmetric/Biological Unit (1, 2)
|
Asymmetric/Biological Unit (1, 2)
|
Asymmetric/Biological Unit (2, 4)
|
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:94 aligned with S10A3_HUMAN | P33764 from UniProtKB/Swiss-Prot Length:101 Alignment length:98 11 21 31 41 51 61 71 81 91 S10A3_HUMAN 2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPC 99 SCOP domains d3nsoa1 A:2-94 automated matches ----- SCOP domains CATH domains -------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -K------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE --------------------------------------------------------S100_CABP PDB: A:58-7-------------------- PROSITE Transcript 1 Exon 1.3 PDB: A:2-47 UniProt: 1-47 Exon 1.4b PDB: A:48-99 (gaps) UniProt: 48-101 Transcript 1 3nso A 2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP----C 99 11 21 31 41 51 61 71 81 91 | | 94 99 Chain B from PDB Type:PROTEIN Length:93 aligned with S10A3_HUMAN | P33764 from UniProtKB/Swiss-Prot Length:101 Alignment length:97 12 22 32 42 52 62 72 82 92 S10A3_HUMAN 3 RPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPC 99 SCOP domains d3nsob1 B:3-94 automated matches ----- SCOP domains CATH domains ------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) --S_100-3nsoB01 B:5-48 --------------------------------------------------- Pfam domains (1) Pfam domains (2) --S_100-3nsoB02 B:5-48 --------------------------------------------------- Pfam domains (2) SAPs(SNPs) K------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE -------------------------------------------------------S100_CABP PDB: B:58-7-------------------- PROSITE Transcript 1 Exon 1.3 PDB: B:3-47 UniProt: 1-47 Exon 1.4b PDB: B:48-99 (gaps) UniProt: 48-101 Transcript 1 3nso B 3 RPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP----C 99 12 22 32 42 52 62 72 82 92 | | 94 99
|
Asymmetric/Biological Unit
|
(no "CATH Domain" information available for 3NSO) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (S10A3_HUMAN | P33764)
|
|
|
|
|
|
|