1KSO - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF APO S100A3

Authors :   P. R. Mittl, G. Fritz, D. F. Sargent, T. J. Richmond, C. W. Heizmann, M. G.

Date :   14 Jan 02 (Deposition) - 31 Jul 02 (Release) - 01 Feb 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym./Biol. Unit : A,B

Keywords :   S100, Ef-Hand, Ca2+ Binding Protein, Zn2+ Binding Protein, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. R. Mittl, G. Fritz, D. F. Sargent, T. J. Richmond, C. W. Heizmann, M. G. Grutter
Metal-Free Miras Phasing: Structure Of Apo-S100A3.
Acta Crystallogr. , Sect. D V. 58 1255 2002
PubMed-ID: 12136135 | Reference-DOI: 10.1107/S0907444902008430

Molecule 1 - S100 CALCIUM-BINDING PROTEIN A3
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Gene	:	S100A3, S100E
	Expression System Plasmid	:	PMALC2-A3
	Expression System Strain	:	TB-1
	Expression System Taxid	:	562
	Expression System Vector Type	:	PMALC2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	S-100E PROTEIN

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1KSO)

(no "Site" information available for 1KSO)

(no "SS Bond" information available for 1KSO)

(no "Cis Peptide Bond" information available for 1KSO)

Asymmetric/Biological Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_061047	R	3	K	S10A3_HUMAN	Polymorphism	36022742	A/B	R	3	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	S100_CABP	PS00303	S-100/ICaBP type calcium binding protein signature.	S10A3_HUMAN	58-79	2	A:58-79 B:58-79

Asymmetric/Biological Unit (2, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000368713	1	ENSE00001447828	chr1:153521848-153521657	192	S10A3_HUMAN	-	0	0	-	-
1.3	ENST00000368713	3	ENSE00001447827	chr1:153520966-153520821	146	S10A3_HUMAN	1-47	47	2	A:2-47 B:2-47	46 46
1.4b	ENST00000368713	4b	ENSE00001424757	chr1:153520322-153519805	518	S10A3_HUMAN	48-101	54	2	A:48-94 B:48-94	47 47

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:93
 aligned with S10A3_HUMAN | P33764 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:93
                                    11        21        31        41        51        61        71        81        91   
           S10A3_HUMAN    2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94
               SCOP domains d1ksoa_ A: Calcyclin (S100)                                                                   SCOP domains
               CATH domains 1ksoA00 A:2-94 EF-hand                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh.......eehhhhhhhhhhhh........hhhhhhhhhhhhhhh...eehhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -K------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------S100_CABP  PDB: A:58-7--------------- PROSITE
               Transcript 1 Exon 1.3  PDB: A:2-47 UniProt: 1-47           Exon 1.4b  PDB: A:48-94 UniProt: 48-101         Transcript 1
                  1kso A  2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94
                                    11        21        31        41        51        61        71        81        91

Chain B from PDB  Type:PROTEIN  Length:93
 aligned with S10A3_HUMAN | P33764 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:93
                                    11        21        31        41        51        61        71        81        91   
           S10A3_HUMAN    2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94
               SCOP domains d1ksob_ B: Calcyclin (S100)                                                                   SCOP domains
               CATH domains 1ksoB00 B:2-94 EF-hand                                                                        CATH domains
           Pfam domains (1) ---S_100-1ksoB01 B:5-48                        ---------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---S_100-1ksoB02 B:5-48                        ---------------------------------------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh......eeehhhhhhhhhhhh........hhhhhhhhhhhh......eeehhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -K------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------S100_CABP  PDB: B:58-7--------------- PROSITE
               Transcript 1 Exon 1.3  PDB: B:2-47 UniProt: 1-47           Exon 1.4b  PDB: B:48-94 UniProt: 48-101         Transcript 1
                  1kso B  2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94
                                    11        21        31        41        51        61        71        81        91

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: EF Hand-like (739)

Superfamily: EF-hand (657)

Family: S100 proteins (101)

Protein domain: Calcyclin (S100) (69)

Human (Homo sapiens), s100a3 [TaxId: 9606] (1)

1a	d1ksoa_	A:
1b	d1ksob_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Recoverin; domain 1 (474)

Homologous Superfamily: EF-hand (412)

Human (Homo sapiens) (106)

1a	1ksoA00	A:2-94
1b	1ksoB00	B:2-94

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: EF_hand (270)

Family: S_100 (63)

Homo sapiens (Human) (41)

1a	S_100-1ksoB01	B:5-48
1b	S_100-1ksoB02	B:5-48

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (S10A3_HUMAN | P33764)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1kso)

	Sites
(no "Sites" information available for 1kso)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1kso)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1kso
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	S10A3_HUMAN \| P33764
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	S10A3_HUMAN \| P33764
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	S10A3_HUMAN \| P33764	:	3nsi 3nsk 3nsl 3nso

(no "Related Entries Specified in the PDB File" available for 1KSO)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (1, 2)

Exons (2, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (5, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File