Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF APO S100A3
 
Authors :  P. R. Mittl, G. Fritz, D. F. Sargent, T. J. Richmond, C. W. Heizmann, M. G.
Date :  14 Jan 02  (Deposition) - 31 Jul 02  (Release) - 01 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A,B
Keywords :  S100, Ef-Hand, Ca2+ Binding Protein, Zn2+ Binding Protein, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. R. Mittl, G. Fritz, D. F. Sargent, T. J. Richmond, C. W. Heizmann, M. G. Grutter
Metal-Free Miras Phasing: Structure Of Apo-S100A3.
Acta Crystallogr. , Sect. D V. 58 1255 2002
PubMed-ID: 12136135  |  Reference-DOI: 10.1107/S0907444902008430

(-) Compounds

Molecule 1 - S100 CALCIUM-BINDING PROTEIN A3
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System GeneS100A3, S100E
    Expression System PlasmidPMALC2-A3
    Expression System StrainTB-1
    Expression System Taxid562
    Expression System Vector TypePMALC2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymS-100E PROTEIN

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1KSO)

(-) Sites  (0, 0)

(no "Site" information available for 1KSO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1KSO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1KSO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric/Biological Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_061047R3KS10A3_HUMANPolymorphism36022742A/BR3K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S10A3_HUMAN58-79
 
  2A:58-79
B:58-79

(-) Exons   (2, 4)

Asymmetric/Biological Unit (2, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003687131ENSE00001447828chr1:153521848-153521657192S10A3_HUMAN-00--
1.3ENST000003687133ENSE00001447827chr1:153520966-153520821146S10A3_HUMAN1-47472A:2-47
B:2-47
46
46
1.4bENST000003687134bENSE00001424757chr1:153520322-153519805518S10A3_HUMAN48-101542A:48-94
B:48-94
47
47

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:93
 aligned with S10A3_HUMAN | P33764 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:93
                                    11        21        31        41        51        61        71        81        91   
           S10A3_HUMAN    2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94
               SCOP domains d1ksoa_ A: Calcyclin (S100)                                                                   SCOP domains
               CATH domains 1ksoA00 A:2-94 EF-hand                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh.......eehhhhhhhhhhhh........hhhhhhhhhhhhhhh...eehhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -K------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------S100_CABP  PDB: A:58-7--------------- PROSITE
               Transcript 1 Exon 1.3  PDB: A:2-47 UniProt: 1-47           Exon 1.4b  PDB: A:48-94 UniProt: 48-101         Transcript 1
                  1kso A  2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94
                                    11        21        31        41        51        61        71        81        91   

Chain B from PDB  Type:PROTEIN  Length:93
 aligned with S10A3_HUMAN | P33764 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:93
                                    11        21        31        41        51        61        71        81        91   
           S10A3_HUMAN    2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94
               SCOP domains d1ksob_ B: Calcyclin (S100)                                                                   SCOP domains
               CATH domains 1ksoB00 B:2-94 EF-hand                                                                        CATH domains
           Pfam domains (1) ---S_100-1ksoB01 B:5-48                        ---------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---S_100-1ksoB02 B:5-48                        ---------------------------------------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh......eeehhhhhhhhhhhh........hhhhhhhhhhhh......eeehhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -K------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------S100_CABP  PDB: B:58-7--------------- PROSITE
               Transcript 1 Exon 1.3  PDB: B:2-47 UniProt: 1-47           Exon 1.4b  PDB: B:48-94 UniProt: 48-101         Transcript 1
                  1kso B  2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94
                                    11        21        31        41        51        61        71        81        91   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: EF_hand (270)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (S10A3_HUMAN | P33764)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1kso)
 
  Sites
(no "Sites" information available for 1kso)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1kso)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1kso
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  S10A3_HUMAN | P33764
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  S10A3_HUMAN | P33764
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        S10A3_HUMAN | P337643nsi 3nsk 3nsl 3nso

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1KSO)