|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1KSO) |
(no "Site" information available for 1KSO) |
(no "SS Bond" information available for 1KSO) |
(no "Cis Peptide Bond" information available for 1KSO) |
Asymmetric/Biological Unit (1, 2)
|
Asymmetric/Biological Unit (1, 2)
|
Asymmetric/Biological Unit (2, 4)
|
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:93 aligned with S10A3_HUMAN | P33764 from UniProtKB/Swiss-Prot Length:101 Alignment length:93 11 21 31 41 51 61 71 81 91 S10A3_HUMAN 2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94 SCOP domains d1ksoa_ A: Calcyclin (S100) SCOP domains CATH domains 1ksoA00 A:2-94 EF-hand CATH domains Pfam domains --------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -K------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------S100_CABP PDB: A:58-7--------------- PROSITE Transcript 1 Exon 1.3 PDB: A:2-47 UniProt: 1-47 Exon 1.4b PDB: A:48-94 UniProt: 48-101 Transcript 1 1kso A 2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94 11 21 31 41 51 61 71 81 91 Chain B from PDB Type:PROTEIN Length:93 aligned with S10A3_HUMAN | P33764 from UniProtKB/Swiss-Prot Length:101 Alignment length:93 11 21 31 41 51 61 71 81 91 S10A3_HUMAN 2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94 SCOP domains d1ksob_ B: Calcyclin (S100) SCOP domains CATH domains 1ksoB00 B:2-94 EF-hand CATH domains Pfam domains (1) ---S_100-1ksoB01 B:5-48 ---------------------------------------------- Pfam domains (1) Pfam domains (2) ---S_100-1ksoB02 B:5-48 ---------------------------------------------- Pfam domains (2) SAPs(SNPs) -K------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------S100_CABP PDB: B:58-7--------------- PROSITE Transcript 1 Exon 1.3 PDB: B:2-47 UniProt: 1-47 Exon 1.4b PDB: B:48-94 UniProt: 48-101 Transcript 1 1kso B 2 ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP 94 11 21 31 41 51 61 71 81 91
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (S10A3_HUMAN | P33764)
|
|
|
|
|
|
|