Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  HTRA PROTEASES ARE ACTIVATED BY A CONSERVED MECHANISM THAT CAN BE TRIGGERED BY DISTINCT MOLECULAR CUES
 
Authors :  T. Krojer, J. Sawa, R. Huber, T. Clausen
Date :  07 Apr 10  (Deposition) - 30 Jun 10  (Release) - 05 Mar 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.96
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (24x)
Keywords :  Degp, Htra, Protease, Outer Membrane Protein, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Krojer, J. Sawa, R. Huber, T. Clausen
Htra Proteases Have A Conserved Activation Mechanism That Can Be Triggered By Distinct Molecular Cues
Nat. Struct. Mol. Biol. V. 17 844 2010
PubMed-ID: 20581825  |  Reference-DOI: 10.1038/NSMB.1840

(-) Compounds

Molecule 1 - PROTEASE DO
    ChainsA
    EC Number3.4.21.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPQE60
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneDEGP
    MutationYES
    Organism ScientificESCHERICHIA COLI
    Organism Taxid83333
    StrainK12
    SynonymDEGP, HTRA
 
Molecule 2 - 5-MER PEPTIDE
    ChainsB, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPQE60
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneDEGP
    Organism ScientificESCHERICHIA COLI
    Organism Taxid83333
    Other DetailsTHIS PEPTIDE APPARENTLY PICKED UP DURING PROTEIN PURIFICATION.
    StrainK12

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (24x)ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 23)

Asymmetric Unit (2, 23)
No.NameCountTypeFull Name
1MSE13Mod. Amino AcidSELENOMETHIONINE
2UNK10Mod. Amino Acid
Biological Unit 1 (1, 312)
No.NameCountTypeFull Name
1MSE312Mod. Amino AcidSELENOMETHIONINE
2UNK-1Mod. Amino Acid

(-) Sites  (0, 0)

(no "Site" information available for 3MH7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3MH7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3MH7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3MH7)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PDZPS50106 PDZ domain profile.DEGP_ECOLI280-371
377-466
  2A:254-345
A:351-440
Biological Unit 1 (1, 48)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PDZPS50106 PDZ domain profile.DEGP_ECOLI280-371
377-466
  48A:254-345
A:351-440

(-) Exons   (0, 0)

(no "Exon" information available for 3MH7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:392
 aligned with DEGP_ECOLI | P0C0V0 from UniProtKB/Swiss-Prot  Length:474

    Alignment length:438
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466        
           DEGP_ECOLI    37 QMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ 474
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) -----------------------------------------------------------------------------Trypsin_2-3mh7A03 A:88-224                                                                                                               --------------------------------------------------------------------------------------------------------------------------------------PDZ-3mh7A01 A:359-437                                                          ----------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PDZ-3mh7A02 A:359-437                                                          ----------- Pfam domains (2)
         Sec.struct. author ....hhhhhhhhh..eeeeeeee..----------------------------------------------..eeeeeeeeeee....eeeeehhhhh.eeeeeee.....eeeeeeeeee....eeeeee............hhhhh....eeeeeehhhhh..eeeeeeeeeeee..........eeee...........eee.....eeeeeeeee.hhhh....eeeeehhhhhhhhhhhhhhh........eeeee.hhhhhhhh.......eeeeee...hhhhhhh.....eeeee..ee..hhhhhhhhhh......eeeeeeee..eeeeeeee.........hhhhhhh.....eee.......eeeee......hhhhh.....ee.ee..ee..hhhhhhhhhhh.....eeeeee..eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PDZ  PDB: A:254-345 UniProt: 280-371                                                        -----PDZ  PDB: A:351-440 UniProt: 377-466                                                      -------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3mh7 A  11 QmPSLAPmLEKVmPSVVSINVEGST----------------------------------------------QKFmALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKmVGKDPRSDIALIQIQNPKNLTAIKmADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNmVKNLTSQmVEYGQVKRGELGImGTELNSELAKAmKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTmPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEmSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLmQ 448
                             |     |20  |     30    |    -         -         -         -         - |  |   90       100       110       120      |130       140       150 |     160       170       180       190       200       210       220       230       240     | 250   |   260       270       280       290       300       310       320       330|      340       350       360       370     | 380       390       400       410       420       430       440      | 
                             |     |    |          35                                             82  |                                       127-MSE                  152-MSE                                                                                       246-MSE 254-MSE       268-MSE     280-MSE                                            331-MSE                                      376-MSE                                                                447-MSE
                            12-MSE |    |                                                            85-MSE                                                                                                                                                                                                                                                                                                                                                                       
                                  18-MSE|                                                                                                                                                                                                                                                                                                                                                                                                                                         
                                       23-MSE                                                                                                                                                                                                                                                                                                                                                                                                                                     

Chain B from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author .eee. Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 3mh7 B 102 xxxxx 106
                            |||||
                            |||||
                          102-UNK
                           103-UNK
                            104-UNK
                             105-UNK
                              106-UNK

Chain C from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..ee. Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 3mh7 C 503 xxxxx 507
                            |||||
                            |||||
                          503-UNK
                           504-UNK
                            505-UNK
                             506-UNK
                              507-UNK

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3MH7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3MH7)

(-) Pfam Domains  (2, 3)

Asymmetric Unit
(-)
Clan: PDZ-like (184)
(-)
Family: PDZ (172)

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)
Chain A   (DEGP_ECOLI | P0C0V0)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0006515    misfolded or incompletely synthesized protein catabolic process    The chemical reactions and pathways resulting in the breakdown of misfolded or attenuated proteins.
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0006979    response to oxidative stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
    GO:0009266    response to temperature stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a temperature stimulus.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030288    outer membrane-bounded periplasmic space    The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNK  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3mh7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3mh7)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3mh7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DEGP_ECOLI | P0C0V0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DEGP_ECOLI | P0C0V0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DEGP_ECOLI | P0C0V01ky9 2zle 3cs0 3mh4 3mh5 3mh6 3otp 3ou0 4a8d

(-) Related Entries Specified in the PDB File

3mh4 3mh5 3mh6