|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 6)
Asymmetric Unit (3, 6)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3LUO) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3LUO) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3LUO) |
Exons (0, 0)| (no "Exon" information available for 3LUO) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:145 aligned with Q5SLE7_THET8 | Q5SLE7 from UniProtKB/TrEMBL Length:149 Alignment length:151 149 10 20 30 40 50 60 70 80 90 100 110 120 130 140 |- Q5SLE7_THET8 1 MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAH-- - SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains FKBP_C-3luoA01 A:1-133 ------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3luo A 1 MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFP------PGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS 151 10 20 30 40 50 60 70 80 | 90 100 110 120 130 140 150 80 87
Chain B from PDB Type:PROTEIN Length:6
SCOP domains ------ SCOP domains
CATH domains ------ CATH domains
Pfam domains ------ Pfam domains
SAPs(SNPs) ------ SAPs(SNPs)
PROSITE ------ PROSITE
Transcript ------ Transcript
3luo B 1 xALPAx 6
| |
1-SIN|
6-NIT
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3LUO) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3LUO) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (Q5SLE7_THET8 | Q5SLE7)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|