|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 17)
Asymmetric Unit (3, 17)
|
Sites (15, 15)
Asymmetric Unit (15, 15)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3LPH) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3LPH) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3LPH) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3LPH) |
Exons (0, 0)| (no "Exon" information available for 3LPH) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:62 aligned with REV_HV1H3 | P69718 from UniProtKB/Swiss-Prot Length:116 Alignment length:62 18 28 38 48 58 68 REV_HV1H3 9 DEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILSTYLGRSAEP 70 SCOP domains -------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 3lph A 9 DEDSLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIRSTYLGRSAEP 70 18 28 38 48 58 68 Chain B from PDB Type:PROTEIN Length:55 aligned with REV_HV1H3 | P69718 from UniProtKB/Swiss-Prot Length:116 Alignment length:55 18 28 38 48 58 REV_HV1H3 9 DEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILSTY 63 SCOP domains ------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------- PROSITE Transcript ------------------------------------------------------- Transcript 3lph B 9 DEDSLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIRSTY 63 18 28 38 48 58 Chain C from PDB Type:PROTEIN Length:58 aligned with REV_HV1H3 | P69718 from UniProtKB/Swiss-Prot Length:116 Alignment length:58 17 27 37 47 57 REV_HV1H3 8 SDEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILSTYLG 65 SCOP domains ---------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 3lph C 8 SDEDSLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIRSTYLG 65 17 27 37 47 57 Chain D from PDB Type:PROTEIN Length:57 aligned with REV_HV1H3 | P69718 from UniProtKB/Swiss-Prot Length:116 Alignment length:57 17 27 37 47 57 REV_HV1H3 8 SDEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILSTYL 64 SCOP domains --------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------- CATH domains Pfam domains (1) REV-3lphD01 D:8-64 Pfam domains (1) Pfam domains (2) REV-3lphD02 D:8-64 Pfam domains (2) Pfam domains (3) REV-3lphD03 D:8-64 Pfam domains (3) Pfam domains (4) REV-3lphD04 D:8-64 Pfam domains (4) SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------- PROSITE Transcript --------------------------------------------------------- Transcript 3lph D 8 SDEDSLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIRSTYL 64 17 27 37 47 57
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3LPH) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3LPH) |
Pfam Domains (1, 4)
Asymmetric Unit
|
Gene Ontology (10, 10)|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (REV_HV1H3 | P69718)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|