|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 8)
|
Asymmetric Unit (8, 8)
|
(no "SS Bond" information available for 3LI6) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 3LI6) |
Asymmetric Unit (2, 12)
|
(no "Exon" information available for 3LI6) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:64 aligned with CALBP_ENTHI | P38505 from UniProtKB/Swiss-Prot Length:134 Alignment length:64 11 21 31 41 51 61 CALBP_ENTHI 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSI 65 SCOP domains d3li6a_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE (1) EF_HAND_2 PDB: - UniProt: 1-32EF_HAND_2 PDB: A:33-65 PROSITE (1) PROSITE (2) --------EF_HAND_1 -----------------------EF_HAND_1 ------- PROSITE (2) Transcript ---------------------------------------------------------------- Transcript 3li6 A 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSI 65 11 21 31 41 51 61 Chain D from PDB Type:PROTEIN Length:65 aligned with CALBP_ENTHI | P38505 from UniProtKB/Swiss-Prot Length:134 Alignment length:65 11 21 31 41 51 61 CALBP_ENTHI 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQ 66 SCOP domains d3li6d_ D: automated matches SCOP domains CATH domains ----------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE (1) EF_HAND_2 PDB: - UniProt: 1-32EF_HAND_2 PDB: D:33-66 PROSITE (1) PROSITE (2) --------EF_HAND_1 -----------------------EF_HAND_1 -------- PROSITE (2) Transcript ----------------------------------------------------------------- Transcript 3li6 D 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQ 66 11 21 31 41 51 61 Chain G from PDB Type:PROTEIN Length:64 aligned with CALBP_ENTHI | P38505 from UniProtKB/Swiss-Prot Length:134 Alignment length:64 11 21 31 41 51 61 CALBP_ENTHI 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSI 65 SCOP domains d3li6g_ G: automated matches SCOP domains CATH domains ---------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE (1) EF_HAND_2 PDB: - UniProt: 1-32EF_HAND_2 PDB: G:33-65 PROSITE (1) PROSITE (2) --------EF_HAND_1 -----------------------EF_HAND_1 ------- PROSITE (2) Transcript ---------------------------------------------------------------- Transcript 3li6 G 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSI 65 11 21 31 41 51 61 Chain J from PDB Type:PROTEIN Length:64 aligned with CALBP_ENTHI | P38505 from UniProtKB/Swiss-Prot Length:134 Alignment length:64 11 21 31 41 51 61 CALBP_ENTHI 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSI 65 SCOP domains d3li6j_ J: automated matches SCOP domains CATH domains ---------------------------------------------------------------- CATH domains Pfam domains (1) efhand-3li6J01 J:2-29 ------------------------------------ Pfam domains (1) Pfam domains (2) efhand-3li6J02 J:2-29 ------------------------------------ Pfam domains (2) Pfam domains (3) efhand-3li6J03 J:2-29 ------------------------------------ Pfam domains (3) Pfam domains (4) efhand-3li6J04 J:2-29 ------------------------------------ Pfam domains (4) SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE (1) EF_HAND_2 PDB: - UniProt: 1-32EF_HAND_2 PDB: J:33-65 PROSITE (1) PROSITE (2) --------EF_HAND_1 -----------------------EF_HAND_1 ------- PROSITE (2) Transcript ---------------------------------------------------------------- Transcript 3li6 J 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSI 65 11 21 31 41 51 61
|
Asymmetric Unit
|
(no "CATH Domain" information available for 3LI6) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,D,G,J (CALBP_ENTHI | P38505)
|
|
|
|
|
|
|