|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 9) Biological Unit 1 (1, 6) Biological Unit 2 (1, 9) Biological Unit 3 (1, 15) Biological Unit 4 (1, 2) Biological Unit 5 (1, 3) |
Asymmetric Unit (8, 8)
|
(no "SS Bond" information available for 2NXQ) |
(no "Cis Peptide Bond" information available for 2NXQ) |
(no "SAP(SNP)/Variant" information available for 2NXQ) |
Asymmetric Unit (2, 6)
|
(no "Exon" information available for 2NXQ) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:66 aligned with CALBP_ENTHI | P38505 from UniProtKB/Swiss-Prot Length:134 Alignment length:66 11 21 31 41 51 61 CALBP_ENTHI 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQG 67 SCOP domains d2nxqa_ A: EHCABP SCOP domains CATH domains ------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) EF_HAND_2 PDB: - UniProt: 1-32EF_HAND_2 PDB: A:33-67 PROSITE (1) PROSITE (2) --------EF_HAND_1 -----------------------EF_HAND_1 --------- PROSITE (2) Transcript ------------------------------------------------------------------ Transcript 2nxq A 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQG 67 11 21 31 41 51 61 Chain B from PDB Type:PROTEIN Length:64 aligned with CALBP_ENTHI | P38505 from UniProtKB/Swiss-Prot Length:134 Alignment length:64 11 21 31 41 51 61 CALBP_ENTHI 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSI 65 SCOP domains d2nxqb_ B: EHCABP SCOP domains CATH domains ---------------------------------------------------------------- CATH domains Pfam domains (1) efhand-2nxqB01 B:2-29 ------------------------------------ Pfam domains (1) Pfam domains (2) efhand-2nxqB02 B:2-29 ------------------------------------ Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE (1) EF_HAND_2 PDB: - UniProt: 1-32EF_HAND_2 PDB: B:33-65 PROSITE (1) PROSITE (2) --------EF_HAND_1 -----------------------EF_HAND_1 ------- PROSITE (2) Transcript ---------------------------------------------------------------- Transcript 2nxq B 2 AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSI 65 11 21 31 41 51 61
|
Asymmetric Unit
|
(no "CATH Domain" information available for 2NXQ) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (CALBP_ENTHI | P38505)
|
|
|
|
|
|
|