Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF DHT-BOUND ANDROGEN RECEPTOR IN COMPLEX WITH THE THIRD MOTIF OF STEROID RECEPTOR COACTIVATOR 3
 
Authors :  X. E. Zhou, K. M. Suino-Powell, J. Li, A. He, J. P. Mackeigan, K. Melcher, E. -L. Yong, H. E. Xu
Date :  18 Dec 09  (Deposition) - 12 Jan 10  (Release) - 31 Mar 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Androgen Receptor, Ligand Binding Domain, Steroid Receptor Coactivator 3, 5-Alpha-Dihydrotestosterone (Dht), Prostate Cancer, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  X. E. Zhou, K. M. Suino-Powell, J. Li, Y. He, J. P. Mackeigan, K. Melcher, E. L. Yong, H. E. Xu
Identification Of Src3/Aib1 As A Preferred Coactivator For Hormone-Activated Androgen Receptor.
J. Biol. Chem. V. 285 9161 2010
PubMed-ID: 20086010  |  Reference-DOI: 10.1074/JBC.M109.085779

(-) Compounds

Molecule 1 - ANDROGEN RECEPTOR
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET24A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: LIGAND BINDING DOMAIN
    Gene: AR, DHTR, NR3C4
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: DIHYDROTESTOSTERONE RECEPTOR, NUCLEAR RECEPTOR SUBFAMILY 3 GROUP C MEMBER 4
 
Molecule 2 - NUCLEAR RECEPTOR COACTIVATOR 3
    Chains: B
    Engineered: YES
    Fragment: RECEPTOR BINDING MOTIF 3
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synthetic: YES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1DHT1Ligand/Ion5-ALPHA-DIHYDROTESTOSTERONE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:704 , ASN A:705 , GLN A:711 , MET A:749 , ARG A:752 , THR A:877BINDING SITE FOR RESIDUE DHT A 1

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:844 -A:852

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3L3Z)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (155, 155)

Asymmetric/Biological Unit (155, 155)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_009761Q671RANDR_HUMANUnclassified  ---AQ670R
002UniProtVAR_009762P672HANDR_HUMANDisease (PAIS)  ---AP671H
003UniProtVAR_009763I673TANDR_HUMANUnclassified  ---AI672T
004UniProtVAR_004688L678PANDR_HUMANDisease (AIS)137852579AL677P
005UniProtVAR_009764E682KANDR_HUMANDisease (AIS)  ---AE681K
006UniProtVAR_013474P683TANDR_HUMANDisease (PAIS)  ---AP682T
007UniProtVAR_009765G684AANDR_HUMANUnclassified  ---AG683A
008UniProtVAR_009766V685IANDR_HUMANDisease (AIS)  ---AV684I
009UniProtVAR_009767C687RANDR_HUMANDisease (PAIS)  ---AC686R
010UniProtVAR_009768A688VANDR_HUMANDisease (PAIS)  ---AA687V
011UniProtVAR_009769G689EANDR_HUMANDisease (AIS)  ---AG688E
012UniProtVAR_004690D696HANDR_HUMANDisease (AIS)  ---AD695H
013UniProtVAR_004691D696NANDR_HUMANDisease (AIS)  ---AD695N
014UniProtVAR_004692D696VANDR_HUMANDisease (AIS)  ---AD695V
015UniProtVAR_009771L701MANDR_HUMANDisease (AIS)  ---AL700M
016UniProtVAR_009772L702FANDR_HUMANDisease (AIS)  ---AL701F
017UniProtVAR_009773L702HANDR_HUMANUnclassified864622007AL701H
018UniProtVAR_009774S703AANDR_HUMANDisease (AIS)  ---AS702A
019UniProtVAR_009775S704CANDR_HUMANDisease (AIS)  ---AS703C
020UniProtVAR_004693S704GANDR_HUMANDisease (AIS)  ---AS703G
021UniProtVAR_009776N706SANDR_HUMANDisease (AIS)  ---AN705S
022UniProtVAR_013475N706YANDR_HUMANDisease (AIS)  ---AN705Y
023UniProtVAR_004694L708RANDR_HUMANDisease (AIS)137852585AL707R
024UniProtVAR_009777G709AANDR_HUMANDisease (PAIS)  ---AG708A
025UniProtVAR_009778G709VANDR_HUMANDisease (AIS)  ---AG708V
026UniProtVAR_009779R711TANDR_HUMANDisease (AIS)  ---AR710T
027UniProtVAR_013476Q712EANDR_HUMANDisease (PAIS)  ---AQ711E
028UniProtVAR_009780L713FANDR_HUMANDisease (PAIS)137852595AL712F
029UniProtVAR_009781V716MANDR_HUMANUnclassified  ---AV715M
030UniProtVAR_009782K718EANDR_HUMANUnclassified  ---AK717E
031UniProtVAR_009783K721EANDR_HUMANUnclassified  ---AK720E
032UniProtVAR_009784A722TANDR_HUMANUnclassified137852583AA721T
033UniProtVAR_009785L723FANDR_HUMANDisease (AIS)  ---AL722F
034UniProtVAR_009786P724SANDR_HUMANDisease (AIS)  ---AP723S
035UniProtVAR_009787G725DANDR_HUMANUnclassified  ---AG724D
036UniProtVAR_009788F726LANDR_HUMANUnclassified  ---AF725L
037UniProtVAR_009789R727LANDR_HUMANUnclassified137852593AR726L
038UniProtVAR_009790N728KANDR_HUMANDisease (AIS)768869912AN727K
039UniProtVAR_009791L729SANDR_HUMANDisease (PAIS)  ---AL728S
040UniProtVAR_004695V731MANDR_HUMANUnclassified137852571AV730M
041UniProtVAR_004696D733NANDR_HUMANDisease (AIS)  ---AD732N
042UniProtVAR_004697D733YANDR_HUMANDisease (AIS)  ---AD732Y
043UniProtVAR_009792Q734HANDR_HUMANDisease (PAIS)  ---AQ733H
044UniProtVAR_009793I738TANDR_HUMANDisease (PAIS)  ---AI737T
045UniProtVAR_009794W742RANDR_HUMANDisease (AIS)  ---AW741R
046UniProtVAR_004698M743IANDR_HUMANDisease (PAIS)  ---AM742I
047UniProtVAR_009795M743VANDR_HUMANDisease (PAIS)  ---AM742V
048UniProtVAR_013477G744EANDR_HUMANDisease (AIS)137852600AG743E
049UniProtVAR_004699G744VANDR_HUMANDisease (AIS)137852600AG743V
050UniProtVAR_009796L745FANDR_HUMANUnclassified  ---AL744F
051UniProtVAR_009797M746TANDR_HUMANDisease (PAIS)  ---AM745T
052UniProtVAR_009798V747MANDR_HUMANDisease (PAIS)  ---AV746M
053UniProtVAR_009799A749DANDR_HUMANDisease (PAIS)  ---AA748D
054UniProtVAR_009800A749TANDR_HUMANUnclassified  ---AA748T
055UniProtVAR_009801A749VANDR_HUMANUnclassified  ---AA748V
056UniProtVAR_009802M750IANDR_HUMANUnclassified  ---AM749I
057UniProtVAR_004700M750VANDR_HUMANDisease (AIS)  ---AM749V
058UniProtVAR_004701G751DANDR_HUMANDisease (AIS)  ---AG750D
059UniProtVAR_009803G751SANDR_HUMANUnclassified  ---AG750S
060UniProtVAR_009804W752RANDR_HUMANDisease (AIS)  ---AW751R
061UniProtVAR_004702R753QANDR_HUMANDisease (AIS)  ---AR752Q
062UniProtVAR_009805F755LANDR_HUMANUnclassified  ---AF754L
063UniProtVAR_004703F755VANDR_HUMANDisease (AIS)  ---AF754V
064UniProtVAR_009806T756AANDR_HUMANUnclassified  ---AT755A
065UniProtVAR_009807N757SANDR_HUMANDisease (PAIS)141425171AN756S
066UniProtVAR_009808V758AANDR_HUMANUnclassified  ---AV757A
067UniProtVAR_009809N759TANDR_HUMANDisease (PAIS)  ---AN758T
068UniProtVAR_009810S760FANDR_HUMANDisease (AIS)  ---AS759F
069UniProtVAR_009811S760PANDR_HUMANUnclassified  ---AS759P
070UniProtVAR_004704L763FANDR_HUMANDisease (AIS)  ---AL762F
071UniProtVAR_004705Y764CANDR_HUMANUnclassified137852567AY763C
072UniProtVAR_009812Y764HANDR_HUMANDisease (AIS)  ---AY763H
073UniProtVAR_009813F765LANDR_HUMANDisease (AIS)  ---AF764L
074UniProtVAR_004707A766TANDR_HUMANDisease (AIS)  ---AA765T
075UniProtVAR_009814A766VANDR_HUMANDisease (AIS)  ---AA765V
076UniProtVAR_009815P767SANDR_HUMANDisease (AIS)  ---AP766S
077UniProtVAR_009816D768EANDR_HUMANDisease (AIS)  ---AD767E
078UniProtVAR_009817L769PANDR_HUMANDisease (AIS)  ---AL768P
079UniProtVAR_009818N772HANDR_HUMANDisease (PAIS)  ---AN771H
080UniProtVAR_009819E773AANDR_HUMANDisease (PAIS)  ---AE772A
081UniProtVAR_009820E773GANDR_HUMANDisease (PAIS)  ---AE772G
082UniProtVAR_004709R775CANDR_HUMANDisease (AIS)137852562AR774C
083UniProtVAR_004708R775HANDR_HUMANDisease (AIS)137852572AR774H
084UniProtVAR_004710R780WANDR_HUMANDisease (AIS)  ---AR779W
085UniProtVAR_004711M781IANDR_HUMANDisease (AIS)137852589AM780I
086UniProtVAR_009821S783NANDR_HUMANUnclassified  ---AS782N
087UniProtVAR_004712C785YANDR_HUMANDisease (AIS)  ---AC784Y
088UniProtVAR_004713M788VANDR_HUMANDisease (AIS)137852570AM787V
089UniProtVAR_009822R789SANDR_HUMANDisease (AIS)  ---AR788S
090UniProtVAR_009823L791FANDR_HUMANDisease (AIS)  ---AL790F
091UniProtVAR_009824S792PANDR_HUMANUnclassified  ---AS791P
092UniProtVAR_009825E794DANDR_HUMANPolymorphism  ---AE793D
093UniProtVAR_004714F795SANDR_HUMANDisease (AIS)  ---AF794S
094UniProtVAR_004715Q799EANDR_HUMANUnclassified137852591AQ798E
095UniProtVAR_009826C807YANDR_HUMANDisease (PAIS)  ---AC806Y
096UniProtVAR_004716M808RANDR_HUMANDisease (AIS)  ---AM807R
097UniProtVAR_009827M808TANDR_HUMANDisease (PAIS)137852592AM807T
098UniProtVAR_004717M808VANDR_HUMANDisease (AIS)  ---AM807V
099UniProtVAR_009828L813FANDR_HUMANDisease (AIS)  ---AL812F
100UniProtVAR_004718S815NANDR_HUMANDisease (AIS)  ---AS814N
101UniProtVAR_009829G821AANDR_HUMANDisease (AIS)  ---AG820A
102UniProtVAR_009830L822VANDR_HUMANDisease (PAIS)  ---AL821V
103UniProtVAR_013478F828VANDR_HUMANDisease (PAIS)  ---AF827V
104UniProtVAR_009831L831PANDR_HUMANUnclassified  ---AL830P
105UniProtVAR_004719R832LANDR_HUMANDisease (AIS)  ---AR831L
106UniProtVAR_004720R832QANDR_HUMANDisease (AIS)  ---AR831Q
107UniProtVAR_009832Y835CANDR_HUMANDisease (AIS)  ---AY834C
108UniProtVAR_004721R841CANDR_HUMANDisease (AIS)137852577AR840C
109UniProtVAR_004722R841GANDR_HUMANDisease (PAIS)  ---AR840G
110UniProtVAR_004723R841HANDR_HUMANDisease (AIS)9332969AR840H
111UniProtVAR_009229R841SANDR_HUMANDisease (PAIS)  ---AR840S
112UniProtVAR_009833I842SANDR_HUMANDisease (PAIS)  ---AI841S
113UniProtVAR_004724I843TANDR_HUMANDisease (AIS)9332970AI842T
114UniProtVAR_009835R855KANDR_HUMANDisease (PAIS)  ---AR854K
115UniProtVAR_004725R856CANDR_HUMANDisease (AIS)  ---AR855C
116UniProtVAR_004726R856HANDR_HUMANDisease (AIS)9332971AR855H
117UniProtVAR_009836F857LANDR_HUMANDisease (AIS)137852598AF856L
118UniProtVAR_009837L864RANDR_HUMANDisease (AIS)  ---AL863R
119UniProtVAR_009838D865GANDR_HUMANDisease (AIS)  ---AD864G
120UniProtVAR_004727D865NANDR_HUMANDisease (AIS)  ---AD864N
121UniProtVAR_009839S866PANDR_HUMANDisease (AIS)137852597AS865P
122UniProtVAR_004728V867EANDR_HUMANDisease (AIS)  ---AV866E
123UniProtVAR_004729V867LANDR_HUMANDisease (PAIS)137852564AV866L
124UniProtVAR_004730V867MANDR_HUMANUnclassified137852564AV866M
125UniProtVAR_004731I870MANDR_HUMANDisease (PAIS)137852574AI869M
126UniProtVAR_009840A871GANDR_HUMANDisease (PAIS)  ---AA870G
127UniProtVAR_009841A871VANDR_HUMANDisease (PAIS)143040492AA870V
128UniProtVAR_009842R872GANDR_HUMANDisease (AIS)  ---AR871G
129UniProtVAR_013479H875RANDR_HUMANDisease (AIS)  ---AH874R
130UniProtVAR_009843H875YANDR_HUMANUnclassified137852581AH874Y
131UniProtVAR_004732T878AANDR_HUMANUnclassified137852578AT877A
132UniProtVAR_009844T878SANDR_HUMANUnclassified137852580AT877S
133UniProtVAR_013480D880YANDR_HUMANDisease (AIS)  ---AD879Y
134UniProtVAR_009845L881QANDR_HUMANUnclassified  ---AL880Q
135UniProtVAR_009846L882VANDR_HUMANDisease (AIS)  ---AL881V
136UniProtVAR_009847M887VANDR_HUMANDisease (AIS)755226547AM886V
137UniProtVAR_009848V890MANDR_HUMANDisease (AIS)  ---AV889M
138UniProtVAR_009849D891NANDR_HUMANUnclassified  ---AD890N
139UniProtVAR_009850F892LANDR_HUMANUnclassified  ---AF891L
140UniProtVAR_004733P893LANDR_HUMANDisease (AIS)  ---AP892L
141UniProtVAR_004734M896TANDR_HUMANDisease (AIS)  ---AM895T
142UniProtVAR_009851A897TANDR_HUMANUnclassified  ---AA896T
143UniProtVAR_009852I899TANDR_HUMANDisease (AIS)  ---AI898T
144UniProtVAR_009853Q903RANDR_HUMANUnclassified137852582AQ902R
145UniProtVAR_009854V904MANDR_HUMANDisease (PAIS)  ---AV903M
146UniProtVAR_009855P905HANDR_HUMANDisease (AIS)  ---AP904H
147UniProtVAR_009856P905SANDR_HUMANDisease (AIS)  ---AP904S
148UniProtVAR_004735L908FANDR_HUMANDisease (AIS)  ---AL907F
149UniProtVAR_009857G910EANDR_HUMANUnclassified  ---AG909E
150UniProtVAR_009858G910RANDR_HUMANDisease (PAIS)  ---AG909R
151UniProtVAR_009859K911RANDR_HUMANUnclassified  ---AK910R
152UniProtVAR_009860V912LANDR_HUMANDisease (PAIS)  ---AV911L
153UniProtVAR_004736P914SANDR_HUMANDisease (PAIS)  ---AP913S
154UniProtVAR_009861F917LANDR_HUMANDisease (AIS)  ---AF916L
155UniProtVAR_009862H918RANDR_HUMANDisease (AIS)  ---AH917R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3L3Z)

(-) Exons   (6, 6)

Asymmetric/Biological Unit (6, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1cENST000003719981cENSE00001935160chr20:46130671-4613076393NCOA3_HUMAN-00--
1.2ENST000003719982ENSE00001456693chr20:46211927-4621200579NCOA3_HUMAN-00--
1.3bENST000003719983bENSE00000845234chr20:46250973-46251074102NCOA3_HUMAN1-28280--
1.5bENST000003719985bENSE00001151230chr20:46252655-46252827173NCOA3_HUMAN28-86590--
1.6ENST000003719986ENSE00000845236chr20:46254125-46254225101NCOA3_HUMAN86-119340--
1.7ENST000003719987ENSE00000845237chr20:46255746-46255920175NCOA3_HUMAN120-178590--
1.8ENST000003719988ENSE00000845238chr20:46256305-46256493189NCOA3_HUMAN178-241640--
1.9ENST000003719989ENSE00000845239chr20:46256666-46256767102NCOA3_HUMAN241-275350--
1.11ENST0000037199811ENSE00000845240chr20:46262240-46262380141NCOA3_HUMAN275-322480--
1.12bENST0000037199812bENSE00001388921chr20:46262792-46262939148NCOA3_HUMAN322-371500--
1.13ENST0000037199813ENSE00000845242chr20:46264066-46264457392NCOA3_HUMAN371-5021320--
1.14ENST0000037199814ENSE00000845243chr20:46264635-46265506872NCOA3_HUMAN502-7922911B:735-74612
1.15ENST0000037199815ENSE00000845244chr20:46266392-46266527136NCOA3_HUMAN793-838460--
1.16ENST0000037199816ENSE00000845245chr20:46267752-46267946195NCOA3_HUMAN838-903660--
1.17aENST0000037199817aENSE00000845246chr20:46268321-46268566246NCOA3_HUMAN903-985830--
1.18ENST0000037199818ENSE00000845247chr20:46268669-46268795127NCOA3_HUMAN985-1027430--
1.19ENST0000037199819ENSE00000845248chr20:46270957-46271128172NCOA3_HUMAN1027-1084580--
1.20ENST0000037199820ENSE00001172838chr20:46275817-46276110294NCOA3_HUMAN1085-1182980--
1.21bENST0000037199821bENSE00000845253chr20:46277749-46277853105NCOA3_HUMAN1183-1217350--
1.22ENST0000037199822ENSE00000845254chr20:46279726-46280020295NCOA3_HUMAN1218-1316990--
1.23ENST0000037199823ENSE00000845258chr20:46281150-46281324175NCOA3_HUMAN1316-1374590--
1.24ENST0000037199824ENSE00001389011chr20:46281675-46281816142NCOA3_HUMAN1374-1421480--
1.25aENST0000037199825aENSE00001855854chr20:46282150-46282363214NCOA3_HUMAN1422-142430--

2.1aENST000003746901aENSE00001326500X:66764465-667666042140ANDR_HUMAN1-5395390--
2.3aENST000003746903aENSE00001165492X:66863098-66863249152ANDR_HUMAN539-590520--
2.5bENST000003746905bENSE00001614300X:66905852-66905968117ANDR_HUMAN590-629400--
2.8ENST000003746908ENSE00001165476X:66931244-66931531288ANDR_HUMAN629-725971A:669-72456
2.9ENST000003746909ENSE00001282597X:66937320-66937464145ANDR_HUMAN725-773491A:724-77249
2.10ENST0000037469010ENSE00001165458X:66941675-66941805131ANDR_HUMAN773-817451A:772-81645
2.11ENST0000037469011ENSE00001316881X:66942669-66942826158ANDR_HUMAN817-869531A:816-868 (gaps)53
2.12bENST0000037469012bENSE00001930911X:66943528-669504616934ANDR_HUMAN870-920511A:869-91850

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:249
 aligned with ANDR_HUMAN | P10275 from UniProtKB/Swiss-Prot  Length:920

    Alignment length:250
                                   679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869       879       889       899       909       919
           ANDR_HUMAN   670 CQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT 919
               SCOP domains d3l3za_ A: Androgen receptor                                                                                                                                                                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------Hormone_recep-3l3zA01 A:686-893                                                                                                                                                                                 ------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhh...-.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..eee..... Sec.struct. author
             SAPs(SNPs) (1) -RHT----P---KTAI-RVE------H----MFAC-S-RA-TEF--M-E--ETFSDLLKS-M-NH---T---RIEFTM-DIDRQ-LASATF--FCLTSEP--HA-C----WI-N-Y--VS-FP-DS---E-------YR----F-N-----AV-----V--PL--C-----CST-----------KCL------RGPE--MGG--R--A-YQV----V--MNLL--TT-T---RMH--F-ERL-S--LR- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------N-----H-G-Y--V-----------------------Y---------VV----TVS---V----P---H-V------G-H--------------------------------T-----------------------Q--------G--------------H--------N-L---V---Y--S--------------------------S----R--------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------------------V----------------------------------------------------V----------------------------------------------------------V--------------------------------H-------------------------M---------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------------------------------------------------------ SAPs(SNPs) (4)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.8  PDB: A:669-724 UniProt: 629-725 [INCOMPLETE]  -----------------------------------------------Exon 2.10  PDB: A:772-816 UniProt: 773-817   ----------------------------------------------------Exon 2.12b  PDB: A:869-918 UniProt: 870-920        Transcript 2 (1)
           Transcript 2 (2) -------------------------------------------------------Exon 2.9  PDB: A:724-772 UniProt: 725-773        -------------------------------------------Exon 2.11  PDB: A:816-868 (gaps) UniProt: 817-869    -------------------------------------------------- Transcript 2 (2)
                 3l3z A 669 SQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACK-KNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT 918
                                   678       688       698       708       718       728       738       748       758       768       778       788       798       808       818       828       838      |848       858       868       878       888       898       908       918
                                                                                                                                                                                                          845 |                                                                       
                                                                                                                                                                                                            847                                                                       

Chain B from PDB  Type:PROTEIN  Length:12
 aligned with NCOA3_HUMAN | Q9Y6Q9 from UniProtKB/Swiss-Prot  Length:1424

    Alignment length:12
                                   744  
          NCOA3_HUMAN   735 NALLRYLLDRDD 746
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
               Transcript 1 Exon 1.14    Transcript 1
                 3l3z B 735 NALLRYLLDRDD 746
                                   744  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3L3Z)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (71, 84)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (ANDR_HUMAN | P10275)
molecular function
    GO:0051117    ATPase binding    Interacting selectively and non-covalently with an ATPase, any enzyme that catalyzes the hydrolysis of ATP.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000978    RNA polymerase II core promoter proximal region sequence-specific DNA binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
    GO:0004879    RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding    Combining with a signal and transmitting the signal to the transcriptional machinery by interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II.
    GO:0001085    RNA polymerase II transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription factor, any protein required to initiate or regulate transcription by RNA polymerase II.
    GO:0005497    androgen binding    Interacting selectively and non-covalently with any androgen, male sex hormones.
    GO:0004882    androgen receptor activity    Combining with an androgen and transmitting the signal to the transcriptional machinery by interacting selectively and non-covalently with an androgen response element in DNA in order to modulate transcription by RNA polymerase II.
    GO:0008013    beta-catenin binding    Interacting selectively and non-covalently with the beta subunit of the catenin complex.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0005496    steroid binding    Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0044212    transcription regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
    GO:0001077    transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0030521    androgen receptor signaling pathway    Any series of molecular signals generated as a consequence of an androgen binding to its receptor.
    GO:0016049    cell growth    The process in which a cell irreversibly increases in size over time by accretion and biosynthetic production of matter similar to that already present.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0007267    cell-cell signaling    Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    GO:0030522    intracellular receptor signaling pathway    Any series of molecular signals initiated by a ligand binding to an receptor located within a cell.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:2001237    negative regulation of extrinsic apoptotic signaling pathway    Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway.
    GO:0045720    negative regulation of integrin biosynthetic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of integrins.
    GO:0051092    positive regulation of NF-kappaB transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
    GO:0045597    positive regulation of cell differentiation    Any process that activates or increases the frequency, rate or extent of cell differentiation.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0045726    positive regulation of integrin biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of integrins.
    GO:0042327    positive regulation of phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to a molecule.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045945    positive regulation of transcription from RNA polymerase III promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase III promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0030850    prostate gland development    The process whose specific outcome is the progression of the prostate gland over time, from its formation to the mature structure. The prostate gland is a partly muscular, partly glandular body that is situated near the base of the mammalian male urethra and secretes an alkaline viscid fluid which is a major constituent of the ejaculatory fluid.
    GO:0051259    protein oligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0090003    regulation of establishment of protein localization to plasma membrane    Any process that modulates the frequency, rate or extent of the directed movement of a protein to a specific location in the plasma membrane.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0007548    sex differentiation    The establishment of the sex of an organism by physical differentiation.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0043401    steroid hormone mediated signaling pathway    A series of molecular signals mediated by a steroid hormone binding to a receptor.
    GO:0006367    transcription initiation from RNA polymerase II promoter    Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0000790    nuclear chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Chain B   (NCOA3_HUMAN | Q9Y6Q9)
molecular function
    GO:0050681    androgen receptor binding    Interacting selectively and non-covalently with an androgen receptor.
    GO:0004402    histone acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + histone = CoA + acetyl-histone.
    GO:0016922    ligand-dependent nuclear receptor binding    Interacting selectively and non-covalently, in a ligand dependent manner, with a nuclear receptor protein.
    GO:0030374    ligand-dependent nuclear receptor transcription coactivator activity    The function of a transcription cofactor that activates transcription in conjuction with a ligand-dependent nuclear receptor from a RNA polymerase II promoter; does not bind DNA itself.
    GO:0035257    nuclear hormone receptor binding    Interacting selectively and non-covalently with a nuclear hormone receptor, a ligand-dependent receptor found in the nucleus of the cell.
    GO:0047485    protein N-terminus binding    Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0046966    thyroid hormone receptor binding    Interacting selectively and non-covalently with a thyroid hormone receptor.
    GO:0003713    transcription coactivator activity    Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0030521    androgen receptor signaling pathway    Any series of molecular signals generated as a consequence of an androgen binding to its receptor.
    GO:0071392    cellular response to estradiol stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
    GO:0016573    histone acetylation    The modification of a histone by the addition of an acetyl group.
    GO:0030522    intracellular receptor signaling pathway    Any series of molecular signals initiated by a ligand binding to an receptor located within a cell.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0045618    positive regulation of keratinocyte differentiation    Any process that activates or increases the frequency, rate or extent of keratinocyte differentiation.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0035624    receptor transactivation    The process in which a receptor is activated by another receptor. Receptor transactivation can occur through different mechanisms and includes cross-talk between signaling pathways where one receptor activates a receptor for a different ligand, and also activation of subunits within a receptor oligomer.
    GO:2001141    regulation of RNA biosynthetic process    Any process that modulates the frequency, rate or extent of RNA biosynthetic process.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0000790    nuclear chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DHT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3l3z)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3l3z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ANDR_HUMAN | P10275
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  NCOA3_HUMAN | Q9Y6Q9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  300068
    Disease Information: OMIM
  312300
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ANDR_HUMAN | P10275
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NCOA3_HUMAN | Q9Y6Q9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ANDR_HUMAN | P10275: 1e3g 1gs4 1t5z 1t63 1t65 1xj7 1xow 1xq3 1z95 2am9 2ama 2amb 2ao6 2ax6 2ax7 2ax8 2ax9 2axa 2hvc 2oz7 2pio 2pip 2piq 2pir 2pit 2piu 2piv 2piw 2pix 2pkl 2pnu 2q7i 2q7j 2q7k 2q7l 2yhd 2ylo 2ylp 2ylq 2z4j 3b5r 3b65 3b66 3b67 3b68 3btr 3l3x 3rlj 3rll 3v49 3v4a 3zqt 4hlw 4k7a 4oea 4oed 4oey 4oez 4ofr 4ofu 4ogh 4oh5 4oh6 4oha 4oil 4oiu 4oj9 4ojb 4ok1 4okb 4okt 4okw 4okx 4olm 4ql8 5cj6 5jjm 5t8e 5t8j 5v8q
        NCOA3_HUMAN | Q9Y6Q9: 1kbh 3l3x

(-) Related Entries Specified in the PDB File

3l3x