Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF N88D MUTANT HIV-1 PROTEASE
 
Authors :  S. C. Bihani, A. Das, V. Prashar, J. L. Ferrer, M. V. Hosur
Date :  24 Nov 09  (Deposition) - 16 Feb 10  (Release) - 16 Feb 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym./Biol. Unit :  A
Keywords :  Drug Resistant Mutation, N88D, Nelfinavir, Hiv-1 Protease, Hydrolase, Protease (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. C. Bihani, A. Das, V. Prashar, J. L. Ferrer, M. V. Hosur
Resistance Mechanism Revealed By Crystal Structures Of Unliganded Nelfinavir-Resistant Hiv-1 Protease Non-Active Site Mutants N88D And N88S.
Biochem. Biophys. Res. Commun. V. 389 295 2009
PubMed-ID: 19720046  |  Reference-DOI: 10.1016/J.BBRC.2009.08.138

(-) Compounds

Molecule 1 - PROTEASE
    ChainsA
    EC Number3.4.23.16
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET11A
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneGAG-POL
    MutationYES
    Organism CommonHIV-1
    Organism ScientificHUMAN IMMUNODEFICIENCY VIRUS TYPE 1
    Organism Taxid11706
    Other DetailsTHE FUSION PROTEIN OF TWO SAME SUBUNITS (UNP RESIDUES 489-587) AND LINKER PEPTIDE GGSSG. TWO SUBUNITS ARE LINKED THROUGH THE LINKER.

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3KT2)

(-) Sites  (0, 0)

(no "Site" information available for 3KT2)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3KT2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3KT2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (78, 78)

Asymmetric/Biological Unit (78, 78)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_POL_HV1H2_001 *R496KPOL_HV1H2  ---  ---AR8K
02UniProtVAR_POL_HV1H2_002 *R496QPOL_HV1H2  ---  ---AR8Q
03UniProtVAR_POL_HV1H2_003 *L498FPOL_HV1H2  ---  ---AL10F
04UniProtVAR_POL_HV1H2_004 *L498IPOL_HV1H2  ---  ---AL10I
05UniProtVAR_POL_HV1H2_005 *L498RPOL_HV1H2  ---  ---AL10R
06UniProtVAR_POL_HV1H2_006 *L498VPOL_HV1H2  ---  ---AL10V
07UniProtVAR_POL_HV1H2_007 *L498YPOL_HV1H2  ---  ---AL10Y
08UniProtVAR_POL_HV1H2_008 *I503VPOL_HV1H2  ---  ---AI15V
09UniProtVAR_POL_HV1H2_009 *G504EPOL_HV1H2  ---  ---AG16E
10UniProtVAR_POL_HV1H2_010 *K508IPOL_HV1H2  ---  ---AK20I
11UniProtVAR_POL_HV1H2_011 *K508MPOL_HV1H2  ---  ---AK20M
12UniProtVAR_POL_HV1H2_012 *K508RPOL_HV1H2  ---  ---AK20R
13UniProtVAR_POL_HV1H2_013 *L511IPOL_HV1H2  ---  ---AL23I
14UniProtVAR_POL_HV1H2_014 *L512IPOL_HV1H2  ---  ---AL24I
15UniProtVAR_POL_HV1H2_015 *D518NPOL_HV1H2  ---  ---AD30N
16UniProtVAR_POL_HV1H2_016 *V520IPOL_HV1H2  ---  ---AV32I
17UniProtVAR_POL_HV1H2_017 *L521FPOL_HV1H2  ---  ---AL33F
18UniProtVAR_POL_HV1H2_018 *E522QPOL_HV1H2  ---  ---AE34Q
19UniProtVAR_POL_HV1H2_019 *E523DPOL_HV1H2  ---  ---AE35D
20UniProtVAR_POL_HV1H2_020 *M524IPOL_HV1H2  ---  ---AM36I
21UniProtVAR_POL_HV1H2_021 *M524LPOL_HV1H2  ---  ---AM36L
22UniProtVAR_POL_HV1H2_022 *S525DPOL_HV1H2  ---  ---AS37D
23UniProtVAR_POL_HV1H2_023 *R529KPOL_HV1H2  ---  ---AR41K
24UniProtVAR_POL_HV1H2_024 *K533IPOL_HV1H2  ---  ---AK45I
25UniProtVAR_POL_HV1H2_025 *M534FPOL_HV1H2  ---  ---AM46F
26UniProtVAR_POL_HV1H2_026 *M534IPOL_HV1H2  ---  ---AM46I
27UniProtVAR_POL_HV1H2_027 *M534LPOL_HV1H2  ---  ---AM46L
28UniProtVAR_POL_HV1H2_028 *I535VPOL_HV1H2  ---  ---AI47V
29UniProtVAR_POL_HV1H2_029 *G536VPOL_HV1H2  ---  ---AG48V
30UniProtVAR_POL_HV1H2_030 *I538LPOL_HV1H2  ---  ---AI50L
31UniProtVAR_POL_HV1H2_031 *I538VPOL_HV1H2  ---  ---AI50V
32UniProtVAR_POL_HV1H2_032 *F541LPOL_HV1H2  ---  ---AF53L
33UniProtVAR_POL_HV1H2_033 *F541YPOL_HV1H2  ---  ---AF53Y
34UniProtVAR_POL_HV1H2_034 *I542APOL_HV1H2  ---  ---AI54A
35UniProtVAR_POL_HV1H2_035 *I542LPOL_HV1H2  ---  ---AI54L
36UniProtVAR_POL_HV1H2_036 *I542MPOL_HV1H2  ---  ---AI54M
37UniProtVAR_POL_HV1H2_037 *I542SPOL_HV1H2  ---  ---AI54S
38UniProtVAR_POL_HV1H2_038 *I542TPOL_HV1H2  ---  ---AI54T
39UniProtVAR_POL_HV1H2_039 *I542VPOL_HV1H2  ---  ---AI54V
40UniProtVAR_POL_HV1H2_040 *K543RPOL_HV1H2  ---  ---AK55R
41UniProtVAR_POL_HV1H2_041 *R545KPOL_HV1H2  ---  ---AR57K
42UniProtVAR_POL_HV1H2_042 *Q546EPOL_HV1H2  ---  ---AQ58E
43UniProtVAR_POL_HV1H2_043 *D548EPOL_HV1H2  ---  ---AD60E
44UniProtVAR_POL_HV1H2_044 *Q549HPOL_HV1H2  ---  ---AQ61H
45UniProtVAR_POL_HV1H2_045 *L551PPOL_HV1H2  ---  ---AL63P
46UniProtVAR_POL_HV1H2_046 *L551TPOL_HV1H2  ---  ---AL63T
47UniProtVAR_POL_HV1H2_047 *E553QPOL_HV1H2  ---  ---AE65Q
48UniProtVAR_POL_HV1H2_048 *I554FPOL_HV1H2  ---  ---AI66F
49UniProtVAR_POL_HV1H2_049 *H557YPOL_HV1H2  ---  ---AH69Y
50UniProtVAR_POL_HV1H2_050 *A559IPOL_HV1H2  ---  ---AA71I
51UniProtVAR_POL_HV1H2_051 *A559LPOL_HV1H2  ---  ---AA71L
52UniProtVAR_POL_HV1H2_052 *A559TPOL_HV1H2  ---  ---AA71T
53UniProtVAR_POL_HV1H2_053 *A559VPOL_HV1H2  ---  ---AA71V
54UniProtVAR_POL_HV1H2_054 *G561SPOL_HV1H2  ---  ---AG73S
55UniProtVAR_POL_HV1H2_055 *V565IPOL_HV1H2  ---  ---AV77I
56UniProtVAR_POL_HV1H2_056 *V570APOL_HV1H2  ---  ---AV82A
57UniProtVAR_POL_HV1H2_057 *V570FPOL_HV1H2  ---  ---AV82F
58UniProtVAR_POL_HV1H2_058 *V570IPOL_HV1H2  ---  ---AV82I
59UniProtVAR_POL_HV1H2_059 *V570SPOL_HV1H2  ---  ---AV82S
60UniProtVAR_POL_HV1H2_060 *V570TPOL_HV1H2  ---  ---AV82T
61UniProtVAR_POL_HV1H2_061 *I572APOL_HV1H2  ---  ---AI84A
62UniProtVAR_POL_HV1H2_062 *I572VPOL_HV1H2  ---  ---AI84V
63UniProtVAR_POL_HV1H2_063 *N576DPOL_HV1H2  ---  ---AD88D
64UniProtVAR_POL_HV1H2_064 *N576SPOL_HV1H2  ---  ---AD88S
65UniProtVAR_POL_HV1H2_065 *L577MPOL_HV1H2  ---  ---AL89M
66UniProtVAR_POL_HV1H2_066 *L578MPOL_HV1H2  ---  ---AL90M
67UniProtVAR_POL_HV1H2_067 *T579SPOL_HV1H2  ---  ---AT91S
68UniProtVAR_POL_HV1H2_068 *I581LPOL_HV1H2  ---  ---AI93L
69UniProtVAR_POL_HV1H2_103 *L687IPOL_HV1H2  ---  ---AL1019I
70UniProtVAR_POL_HV1H2_104 *K688EPOL_HV1H2  ---  ---AK1020E
71UniProtVAR_POL_HV1H2_105 *K688PPOL_HV1H2  ---  ---AK1020P
72UniProtVAR_POL_HV1H2_106 *K688QPOL_HV1H2  ---  ---AK1020Q
73UniProtVAR_POL_HV1H2_113 *V695IPOL_HV1H2  ---  ---AL1023I
74UniProtVAR_POL_HV1H2_129 *M771IPOL_HV1H2  ---  ---AA1028I
75UniProtVAR_POL_HV1H2_130 *M771TPOL_HV1H2  ---  ---AA1028T
76UniProtVAR_POL_HV1H2_131 *M771VPOL_HV1H2  ---  ---AA1028V
77UniProtVAR_POL_HV1H2_155 *L870IPOL_HV1H2  ---  ---AL1063I
78UniProtVAR_POL_HV1H2_159 *T973IPOL_HV1H2  ---  ---AT1080I
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (4, 4)

Asymmetric/Biological Unit (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ASP_PROT_RETROVPS50175 Aspartyl protease, retroviral-type family profile.POL_HV1H2508-577  1A:20-89
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.POL_HV1H2510-521  1A:22-33
3RT_POLPS50878 Reverse transcriptase (RT) catalytic domain profile.POL_HV1H2631-821  1A:1014-1035
4RNASE_HPS50879 RNase H domain profile.POL_HV1H21021-1144  1A:1084-1098

(-) Exons   (0, 0)

(no "Exon" information available for 3KT2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:198
 aligned with POL_HV1H2 | P04585 from UniProtKB/Swiss-Prot  Length:1435

    Alignment length:594
                                   498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758       768       778       788       798       808       818       828       838       848       858       868       878       888       898       908       918       928       938       948       958       968       978       988       998      1008      1018      1028      1038      1048      1058      1068      1078    
           POL_HV1H2    489 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNI 1082
               SCOP domains d3kt2a1 A:1-99 Human immunodeficiency virus type 1 protease                                        ------------------d3kt2a      2 A:100           1-1                                              099 H    uman i                                                                       mmu             nodefic                                       ienc  y v    irus       type 1 proteas                 e                                                                                                                                                                                                   SCOP domains
               CATH domains 3kt2A01 A:1-99 Acid Proteases                                                                      ------------------3kt2A0      2 A:100           1-1                                              099 A    cid Pr                                                                       ote             ases                                                                                                                                                                                                                                                                                                     CATH domains
               Pfam domains ---RVP-3kt2A01 A:4-98                                                                             ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee......eeeeee..eeeeeee.......ee.........eeeeeee..eeeeeeeeeeeeeee..eeeeeeeee......eehhhhhhhhh.eee.------------------......------...eeee-----------ee.----------------------------------------------.eeee----eee...-----------------------------------------------------------------------...-------------.ee....---------------------------------------....--.ee----eeee------e..eeeeeeeeeeee-----------------eee..eeeee---------------------------------------------------------------------eeee....-----------------------------..---------------eehhh----------------------------------------------hhhhhh.eee. Sec.struct. author
             SAPs(SNPs) (1) -------K-F----VE---I--II-----N-IFQDID---K---IFVV-L--LAR-KE-EH-P-QF--Y-I-S---I----A-A---DMMS-L---------------------------------------------------------------------------------------------------------IE------I---------------------------------------------------------------------------I--------------------------------------------------------------------------------------------------I------------------------------------------------------------------------------------------------------I------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------Q-I---------M---------------L---------I---V--YL--------T-------L----------F-V---S---------------------------------------------------------------------------------------------------------------P----------------------------------------------------------------------------------T----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------R---------R-------------------------L-------M----------------T----------I---------------------------------------------------------------------------------------------------------------------Q----------------------------------------------------------------------------------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------V-------------------------------------------S----------------V----------S-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ---------Y-------------------------------------------T---------------------------T-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) -----------------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (6)
                PROSITE (1) -------------------ASP_PROT_RETROV  PDB: A:20-89 UniProt: 508-577                        -----------------------------------------------------RT_POL  PDB: A:1014-1035 UniProt: 631-821                                                                                                                                                      -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNASE_H  PDB: A:1084-1098 UniProt: 1021-1144                   PROSITE (1)
                PROSITE (2) ---------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3kt2 A    1 PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGMTLNF------------------PQVTLW------QRPLVTI-----------KIG----------------------------------------------GQLKE----ALLDTG-----------------------------------------------------------------------ADD-------------TVLEEMS---------------------------------------LPGR--WKP----KMIG------GIGGFIKVRQYDQIL-----------------IEICGHKAIG---------------------------------------------------------------------TVLVGPTP-----------------------------VN---------------IIGRD----------------------------------------------LLTQIGMTLNF 1099
                                    10        20        30        40        50        60        70        80        90        |-         -      1003  |   1007     |   -      1016         -         -         -         -      1020|    |1026|        -         -         -         -         -         -         -  | |    -      1032    |    -         -         -         -    |  | -| |   1047|     1051      1061 |       -      1064        |-         -         -         -         -         -         -      1075     |   -         -         -     ||  -         -  |   |  -         -         -         -         -   |  1095    
                                                                                                                             99               1001 1006   1007  1013        1014 |                                           1017   | 1022 1027                                                                    1028 |          1031  1037                                    1038  |  | | 1045  |   1049          1063              1064     1073                                                                  1074   1081                          1082|            1084   |                                           1089          
                                                                                                                                                                              1016                                               1021                                                                                1030                                                           1041  | |    1048                                                                                                                                                        1083                1088                                                         
                                                                                                                                                                                                                                                                                                                                                                                       1042 |                                                                                                                                                                                                                                                 
                                                                                                                                                                                                                                                                                                                                                                                         1044                                                                                                                                                                                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (59, 59)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (POL_HV1H2 | P04585)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003887    DNA-directed DNA polymerase activity    Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1); the synthesis of DNA from deoxyribonucleotide triphosphates in the presence of a DNA template and a 3'hydroxyl group.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0004523    RNA-DNA hybrid ribonuclease activity    Catalysis of the endonucleolytic cleavage of RNA in RNA-DNA hybrids to 5'-phosphomonoesters.
    GO:0003964    RNA-directed DNA polymerase activity    Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1). Catalyzes RNA-template-directed extension of the 3'- end of a DNA strand by one deoxynucleotide at a time.
    GO:0004190    aspartic-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0004519    endonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by creating internal breaks.
    GO:0004533    exoribonuclease H activity    Catalysis of the exonucleolytic cleavage of RNA to 5'-phosphomonoester oligonucleotides in both 5' to 3' and 3' to 5' directions.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0008907    integrase activity    Catalysis of the integration of one segment of DNA into another.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0015074    DNA integration    The process in which a segment of DNA is incorporated into another, usually larger, DNA molecule such as a chromosome.
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0090503    RNA phosphodiester bond hydrolysis, exonucleolytic    The chemical reactions and pathways involving the hydrolysis of terminal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0006278    RNA-dependent DNA biosynthetic process    A DNA biosynthetic process that uses RNA as a template for RNA-dependent DNA polymerases (e.g. reverse transcriptase) that synthesize the new strand.
    GO:0030260    entry into host cell    The invasion by an organism of a cell of its host organism. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0075713    establishment of integrated proviral latency    A process by which the virus integrates into the host genome and establishes as a stable provirus or prophage.
    GO:0019064    fusion of virus membrane with host plasma membrane    Fusion of a viral membrane with the host cell membrane during viral entry. Results in release of the virion contents into the cytoplasm.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0039526    modulation by virus of host apoptotic process    Any process in which a virus modulates the frequency, rate or extent of apoptosis of infected host cells.
    GO:0051169    nuclear transport    The directed movement of substances into, out of, or within the nucleus.
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0039657    suppression by virus of host gene expression    Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of gene expression in the host organism. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Some protein processing events may be included when they are required to form an active form of a product from an inactive precursor form.
    GO:0019061    uncoating of virus    The process by which an incoming virus is disassembled in the host cell to release a replication-competent viral genome.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0019072    viral genome packaging    The encapsulation of the viral genome within the capsid.
    GO:0019058    viral life cycle    A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
    GO:0075732    viral penetration into host nucleus    The crossing by the virus of the host nuclear membrane, either as naked viral genome or for small viruses as an intact capsid.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019076    viral release from host cell    The dissemination of mature viral particles from the host cell, e.g. by cell lysis or the budding of virus particles from the cell membrane.
    GO:0019068    virion assembly    A late phase of the viral life cycle during which all the components necessary for the formation of a mature virion collect at a particular site in the cell and the basic structure of the virus particle is formed.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.
    GO:0044174    host cell endosome    A membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to host cell lysosomes for degradation.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0042025    host cell nucleus    A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0020002    host cell plasma membrane    The plasma membrane surrounding a host cell.
    GO:0072494    host multivesicular body    A late endosome in which regions of the limiting host cell endosomal membrane invaginate to form internal vesicles; host membrane proteins that enter the internal vesicles are sequestered from the host cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019013    viral nucleocapsid    The complete protein-nucleic acid complex that is the packaged form of the genome in a virus particle.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.
    GO:0055036    virion membrane    The lipid bilayer surrounding a virion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3kt2)
 
  Sites
(no "Sites" information available for 3kt2)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3kt2)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3kt2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  POL_HV1H2 | P04585
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.23.16
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  POL_HV1H2 | P04585
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        POL_HV1H2 | P045851a30 1bv7 1bv9 1bve 1bvg 1bwa 1bwb 1c0t 1c0u 1c1b 1c1c 1dmp 1dtq 1dtt 1e6j 1ep4 1esk 1ex4 1exq 1fb7 1fk9 1fko 1fkp 1g6l 1hiv 1hvh 1hvr 1hwr 1hxb 1jkh 1jla 1jlb 1jlc 1jle 1jlf 1jlg 1jlq 1klm 1lv1 1lw0 1lw2 1lwc 1lwe 1lwf 1ncp 1o1w 1odw 1odx 1ody 1qbr 1qbs 1qbt 1qbu 1rev 1rt1 1rt2 1rt3 1rt4 1rt5 1rt6 1rt7 1rtd 1rth 1rti 1rtj 1s1t 1s1u 1s1v 1s1w 1s1x 1t05 1tam 1tkt 1tkx 1tkz 1tl1 1tl3 1vrt 1vru 2hnd 2hny 2hnz 2kod 2nph 2opp 2opq 2opr 2ops 2rf2 2rki 2whh 2wom 2won 2ynf 2yng 2ynh 2yni 3ao2 3c6t 3c6u 3di6 3dle 3dlg 3dm2 3dmj 3dok 3dol 3dox 3drp 3drr 3drs 3dya 3e01 3ffi 3i0r 3i0s 3kjv 3kk1 3kk2 3kk3 3kt5 3lak 3lal 3lam 3lan 3lp0 3lp1 3lp2 3m8p 3m8q 3mec 3med 3mee 3meg 3mim 3n3i 3nbp 3phv 3qin 3qio 3qip 3t19 3t1a 3tam 4b3o 4b3p 4b3q 4i7f 4kse 4kv8 4ncg 4q1w 4q1x 4q1y 4q5m 4qlh 4u1h 4u1i 4u1j 4u7q 4u7v 5dgu 5dgw 5eu7 5hrn 5hrp 5hrr 5hrs 5im7 5j2m 5j2n 5j2p 5j2q 5k14 5t82

(-) Related Entries Specified in the PDB File

3kt5