Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HIV-1 REVERSE TRANSCRIPTASE
 
Authors :  J. Ren, R. Esnouf, A. Hopkins, C. Ross, Y. Jones, D. Stammers, D. Stuart
Date :  17 Sep 95  (Deposition) - 14 Oct 96  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Aids, Polyprotein, Hydrolase, Aspartyl Protease, Endonuclease, Nucleotidyltransferase, Hiv-1 Reverse Transcriptase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Ren, R. Esnouf, A. Hopkins, C. Ross, Y. Jones, D. Stammers, D. Stuart
The Structure Of Hiv-1 Reverse Transcriptase Complexed With 9-Chloro-Tibo: Lessons For Inhibitor Design.
Structure V. 3 915 1995
PubMed-ID: 8535785  |  Reference-DOI: 10.1016/S0969-2126(01)00226-X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HIV-1 REVERSE TRANSCRIPTASE
    Cell Line293
    ChainsA
    EC Number2.7.7.49
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Strain293
    Expression System Taxid562
    GeneHIV-1 POL
    Organism ScientificHUMAN IMMUNODEFICIENCY VIRUS 1
    Organism Taxid11676
    StrainHXB2 ISOLATE
    SynonymHIV-1 RT
 
Molecule 2 - HIV-1 REVERSE TRANSCRIPTASE
    Cell Line293
    ChainsB
    EC Number2.7.7.49
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Strain293
    Expression System Taxid562
    GeneHIV-1 POL
    Organism ScientificHUMAN IMMUNODEFICIENCY VIRUS 1
    Organism Taxid11676
    StrainHXB2 ISOLATE
    SynonymHIV-1 RT

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
1CSD1Mod. Amino Acid3-SULFINOALANINE
2MG1Ligand/IonMAGNESIUM ION
3TB91Ligand/Ion4-CHLORO-8-METHYL-7-(3-METHYL-BUT-2-ENYL)-6,7,8,9-TETRAHYDRO-2H-2,7,9A-TRIAZA-BENZO[CD]AZULENE-1-THIONE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:442 , ASP A:443 , HOH A:1108BINDING SITE FOR RESIDUE MG A 1000
2AC2SOFTWAREPRO A:95 , LEU A:100 , LYS A:101 , VAL A:179 , TYR A:181 , TRP A:229 , HIS A:235BINDING SITE FOR RESIDUE TB9 A 999

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1REV)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Pro A:225 -Pro A:226
2Pro A:420 -Pro A:421

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (91, 178)

Asymmetric/Biological Unit (91, 178)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_POL_HV1H2_069 *M628LPOL_HV1H2  ---  ---A/BM41L
02UniProtVAR_POL_HV1H2_070 *E631APOL_HV1H2  ---  ---A/BE44A
03UniProtVAR_POL_HV1H2_071 *E631DPOL_HV1H2  ---  ---A/BE44D
04UniProtVAR_POL_HV1H2_072 *P639RPOL_HV1H2  ---  ---A/BP52R
05UniProtVAR_POL_HV1H2_073 *N641DPOL_HV1H2  ---  ---A/BN54D
06UniProtVAR_POL_HV1H2_074 *A649VPOL_HV1H2  ---  ---A/BA62V
07UniProtVAR_POL_HV1H2_075 *K652RPOL_HV1H2  ---  ---A/BK65R
08UniProtVAR_POL_HV1H2_076 *D654APOL_HV1H2  ---  ---A/BD67A
09UniProtVAR_POL_HV1H2_077 *D654EPOL_HV1H2  ---  ---A/BD67E
10UniProtVAR_POL_HV1H2_078 *D654GPOL_HV1H2  ---  ---A/BD67G
11UniProtVAR_POL_HV1H2_079 *D654NPOL_HV1H2  ---  ---A/BD67N
12UniProtVAR_POL_HV1H2_080 *D654SPOL_HV1H2  ---  ---A/BD67S
13UniProtVAR_POL_HV1H2_081 *S655GPOL_HV1H2  ---  ---A/BS68G
14UniProtVAR_POL_HV1H2_082 *S655NPOL_HV1H2  ---  ---A/BS68N
15UniProtVAR_POL_HV1H2_083 *S655YPOL_HV1H2  ---  ---A/BS68Y
16UniProtVAR_POL_HV1H2_084 *T656APOL_HV1H2  ---  ---A/BT69A
17UniProtVAR_POL_HV1H2_085 *T656DPOL_HV1H2  ---  ---A/BT69D
18UniProtVAR_POL_HV1H2_086 *T656GPOL_HV1H2  ---  ---A/BT69G
19UniProtVAR_POL_HV1H2_087 *T656NPOL_HV1H2  ---  ---A/BT69N
20UniProtVAR_POL_HV1H2_088 *K657EPOL_HV1H2  ---  ---A/BK70E
21UniProtVAR_POL_HV1H2_089 *K657RPOL_HV1H2  ---  ---A/BK70R
22UniProtVAR_POL_HV1H2_090 *K657SPOL_HV1H2  ---  ---A/BK70S
23UniProtVAR_POL_HV1H2_091 *L661IPOL_HV1H2  ---  ---A/BL74I
24UniProtVAR_POL_HV1H2_092 *L661VPOL_HV1H2  ---  ---A/BL74V
25UniProtVAR_POL_HV1H2_093 *V662IPOL_HV1H2  ---  ---A/BV75I
26UniProtVAR_POL_HV1H2_094 *V662LPOL_HV1H2  ---  ---A/BV75L
27UniProtVAR_POL_HV1H2_095 *V662MPOL_HV1H2  ---  ---A/BV75M
28UniProtVAR_POL_HV1H2_096 *V662TPOL_HV1H2  ---  ---A/BV75T
29UniProtVAR_POL_HV1H2_097 *F664LPOL_HV1H2  ---  ---A/BF77L
30UniProtVAR_POL_HV1H2_098 *W675GPOL_HV1H2  ---  ---A/BW88G
31UniProtVAR_POL_HV1H2_099 *W675SPOL_HV1H2  ---  ---A/BW88S
32UniProtVAR_POL_HV1H2_100 *E676GPOL_HV1H2  ---  ---A/BE89G
33UniProtVAR_POL_HV1H2_101 *E676KPOL_HV1H2  ---  ---A/BE89K
34UniProtVAR_POL_HV1H2_102 *L679IPOL_HV1H2  ---  ---A/BL92I
35UniProtVAR_POL_HV1H2_103 *L687IPOL_HV1H2  ---  ---A/BL100I
36UniProtVAR_POL_HV1H2_104 *K688EPOL_HV1H2  ---  ---A/BK101E
37UniProtVAR_POL_HV1H2_105 *K688PPOL_HV1H2  ---  ---A/BK101P
38UniProtVAR_POL_HV1H2_106 *K688QPOL_HV1H2  ---  ---A/BK101Q
39UniProtVAR_POL_HV1H2_107 *K690EPOL_HV1H2  ---  ---A/BK103E
40UniProtVAR_POL_HV1H2_108 *K690NPOL_HV1H2  ---  ---A/BK103N
41UniProtVAR_POL_HV1H2_109 *K690RPOL_HV1H2  ---  ---A/BK103R
42UniProtVAR_POL_HV1H2_110 *V693APOL_HV1H2  ---  ---A/BV106A
43UniProtVAR_POL_HV1H2_111 *V693IPOL_HV1H2  ---  ---A/BV106I
44UniProtVAR_POL_HV1H2_112 *V693MPOL_HV1H2  ---  ---A/BV106M
45UniProtVAR_POL_HV1H2_113 *V695IPOL_HV1H2  ---  ---A/BV108I
46UniProtVAR_POL_HV1H2_114 *Y702FPOL_HV1H2  ---  ---A/BY115F
47UniProtVAR_POL_HV1H2_115 *F703YPOL_HV1H2  ---  ---A/BF116Y
48UniProtVAR_POL_HV1H2_116 *V705IPOL_HV1H2  ---  ---A/BV118I
49UniProtVAR_POL_HV1H2_117 *P706SPOL_HV1H2  ---  ---A/BP119S
50UniProtVAR_POL_HV1H2_118 *I722LPOL_HV1H2  ---  ---A/BI135L
51UniProtVAR_POL_HV1H2_119 *I722MPOL_HV1H2  ---  ---A/BI135M
52UniProtVAR_POL_HV1H2_120 *I722TPOL_HV1H2  ---  ---A/BI135T
53UniProtVAR_POL_HV1H2_121 *E725KPOL_HV1H2  ---  ---A/BE138K
54UniProtVAR_POL_HV1H2_122 *Q732MPOL_HV1H2  ---  ---A/BQ145M
55UniProtVAR_POL_HV1H2_123 *Q738MPOL_HV1H2  ---  ---A/BQ151M
56UniProtVAR_POL_HV1H2_124 *S743APOL_HV1H2  ---  ---A/BS156A
57UniProtVAR_POL_HV1H2_125 *P744SPOL_HV1H2  ---  ---A/BP157S
58UniProtVAR_POL_HV1H2_126 *Q748LPOL_HV1H2  ---  ---A/BQ161L
59UniProtVAR_POL_HV1H2_127 *V766DPOL_HV1H2  ---  ---A/BV179D
60UniProtVAR_POL_HV1H2_128 *Y768CPOL_HV1H2  ---  ---A/BY181C
61UniProtVAR_POL_HV1H2_129 *M771IPOL_HV1H2  ---  ---A/BM184I
62UniProtVAR_POL_HV1H2_130 *M771TPOL_HV1H2  ---  ---A/BM184T
63UniProtVAR_POL_HV1H2_131 *M771VPOL_HV1H2  ---  ---A/BM184V
64UniProtVAR_POL_HV1H2_132 *Y775CPOL_HV1H2  ---  ---A/BY188C
65UniProtVAR_POL_HV1H2_133 *Y775HPOL_HV1H2  ---  ---A/BY188H
66UniProtVAR_POL_HV1H2_134 *Y775LPOL_HV1H2  ---  ---A/BY188L
67UniProtVAR_POL_HV1H2_135 *V776IPOL_HV1H2  ---  ---A/BV189I
68UniProtVAR_POL_HV1H2_136 *G777APOL_HV1H2  ---  ---A/BG190A
69UniProtVAR_POL_HV1H2_137 *G777CPOL_HV1H2  ---  ---A/BG190C
70UniProtVAR_POL_HV1H2_138 *G777EPOL_HV1H2  ---  ---A/BG190E
71UniProtVAR_POL_HV1H2_139 *G777QPOL_HV1H2  ---  ---A/BG190Q
72UniProtVAR_POL_HV1H2_140 *G777SPOL_HV1H2  ---  ---A/BG190S
73UniProtVAR_POL_HV1H2_141 *G777TPOL_HV1H2  ---  ---A/BG190T
74UniProtVAR_POL_HV1H2_142 *G777VPOL_HV1H2  ---  ---A/BG190V
75UniProtVAR_POL_HV1H2_143 *H795YPOL_HV1H2  ---  ---A/BH208Y
76UniProtVAR_POL_HV1H2_144 *L797WPOL_HV1H2  ---  ---A/BL210W
77UniProtVAR_POL_HV1H2_145 *R798KPOL_HV1H2  ---  ---A/BR211K
78UniProtVAR_POL_HV1H2_146 *L801FPOL_HV1H2  ---  ---A/BL214F
79UniProtVAR_POL_HV1H2_147 *T802FPOL_HV1H2  ---  ---A/BT215F
80UniProtVAR_POL_HV1H2_148 *T802YPOL_HV1H2  ---  ---A/BT215Y
81UniProtVAR_POL_HV1H2_149 *K806EPOL_HV1H2  ---  ---AK219E
82UniProtVAR_POL_HV1H2_150 *K806QPOL_HV1H2  ---  ---AK219Q
83UniProtVAR_POL_HV1H2_151 *K806RPOL_HV1H2  ---  ---AK219R
84UniProtVAR_POL_HV1H2_152 *P812HPOL_HV1H2  ---  ---AP225H
85UniProtVAR_POL_HV1H2_153 *P823LPOL_HV1H2  ---  ---A/BP236L
86UniProtVAR_POL_HV1H2_154 *K825TPOL_HV1H2  ---  ---A/BK238T
87UniProtVAR_POL_HV1H2_155 *L870IPOL_HV1H2  ---  ---A/BL283I
88UniProtVAR_POL_HV1H2_156 *Y905FPOL_HV1H2  ---  ---A/BY318F
89UniProtVAR_POL_HV1H2_157 *G920DPOL_HV1H2  ---  ---A/BG333D
90UniProtVAR_POL_HV1H2_158 *G920EPOL_HV1H2  ---  ---A/BG333E
91UniProtVAR_POL_HV1H2_159 *T973IPOL_HV1H2  ---  ---A/BT386I
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 3)

Asymmetric/Biological Unit (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RT_POLPS50878 Reverse transcriptase (RT) catalytic domain profile.POL_HV1H2631-821
 
  2A:44-234
B:44-234
2RNASE_HPS50879 RNase H domain profile.POL_HV1H21021-1144  1A:434-539

(-) Exons   (0, 0)

(no "Exon" information available for 1REV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:525
 aligned with POL_HV1H2 | P04585 from UniProtKB/Swiss-Prot  Length:1435

    Alignment length:536
                                   600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      
           POL_HV1H2    591 PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH 1126
               SCOP domains d1reva2 A:4-429 HIV-1 reverse transcriptase                                                                                                                                                                                                                                                                                                                                                                                               d1reva1 A:430-           539 HIV RNase H (Domain of reverse transcriptase)                                     SCOP domains
               CATH domains 1revA01 A:4-90,A:116-156 HIV Type 1 Reverse Transcriptase, subunit A, domain 1         1revA02                  1revA01 A:4-90,A:116-156                 1revA02 A:91-115,A:157-225  [code=3.30.70.270, no name defined]      1revA03 A:226-319  [code=3.30.70.270, no name defined]                                        1revA04 A:320-426  [code=3.30.70.270, no name defined]                                                     1revA05 A:427-537             [code=3.30.420.10, no name defined]                                              -- CATH domains
               Pfam domains -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNase_H-1           revA01 A:435-539                                                                      Pfam domains
         Sec.struct. author ........................hhhhhhhhhhhhhhhh...eee..........eeeee......eeeee..hhhhhh.............hhh.....eeeee............hhhhhhh.eee.........eeeee.........hhhhhhhhhhhhhhhhhhh...eeeeee..eeeeee...hhhhhhhhhhhhhhhh...........................................hhhhhhhhhhhhhhhh.......hhhhhhh.............hhhhhhhhhhhhhh...............eeeeee.....eeeeee.....eeeeeee.........hhhhhhhhhhhhhhhhhhhh....eeee...hhhhhhhhhh.........eee.....................eeeee.-----------.eeee....eee.......hhhhhhhhhhhhhhh...eeeeee..hhhhhhhhh.......hhhhhhhhhhhh..eeeeee.... Sec.struct. author
             SAPs(SNPs) (1) -------------------------------------L--A-------R-D-------V--R-AGAE---II-L----------GG--I-------IE-E--A-I------FY-IS---------------L--K------M-----M----AS---L-----------------D-C--I---CIA-----------------Y-WK--FF---E-----H----------L-T--------------------------------------------I----------------------------------F--------------D----------------------------------------------------I--------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------D----------------------ENDR---VL------------SK-----------P-N--I----------------------------M------------------------------------------------T---H-C------------------------Y---Q-----------------------------------------------------------------------------------------------------------------E-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------------------------------------------------------------GYGS----M-------------------------Q-R--M----------------------------T------------------------------------------------V---L-E----------------------------R-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------------------------------------------------------N-N-----T------------------------------------------------------------------------------------------------------------------Q------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ---------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------S------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (6)
             SAPs(SNPs) (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (7)
                    PROSITE ----------------------------------------RT_POL  PDB: A:44-234 UniProt: 631-821                                                                                                                                                         -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RNASE_H  PDB: A:434-539 UniProt: 1021-1144                                                                 PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1rev A    4 PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLcKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVD-----------AGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH  539
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273      |283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443         - |     463       473       483       493       503       513       523       533      
                                                                                                                                                                                                                                                                                                              280-CSD                                                                                                                                                            443         455                                                                                    

Chain B from PDB  Type:PROTEIN  Length:412
 aligned with POL_HV1H2 | P04585 from UniProtKB/Swiss-Prot  Length:1435

    Alignment length:427
                                   598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758       768       778       788       798       808       818       828       838       848       858       868       878       888       898       908       918       928       938       948       958       968       978       988       998      1008       
           POL_HV1H2    589 ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ 1015
               SCOP domains d1revb_ B: HIV-1 reverse transcriptase                                                                                                                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1revB01 B:2-93,B:116-156 HIV Type 1 Reverse Transcriptase, subunit A, domain 1              1revB02               1revB01 B:2-93,B:116-156                 1revB02 B:94-115,B:157-238  [code=3.30.70.270, no name defi               ned]    1revB03 B:239-319  [code=3.30.70.270, no name defined]                           1revB04 B:320-426  [code=3.30.70.270, no name defined]                                                     -- CATH domains
           Pfam domains (1) -------------------------------------------------------------RVT_1-1revB01 B:63-234                                                                                                                                                      ---RVT_thumb-1revB05 B:238-307                                           ---------RVT_connect-1revB03 B:317-419                                                                          --------- Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------RVT_1-1revB02 B:63-234                                                                                                                                                      ---RVT_thumb-1revB06 B:238-307                                           ---------RVT_connect-1revB04 B:317-419                                                                          --------- Pfam domains (2)
         Sec.struct. author ..........................hhhhhhhhhhhhhhhh...eee.........eeeeee......eeeeee.hhhhhh..............hhhhh..eeeeeehhhhhhh......hhhhh.eee..hhh....eeeee.......hhhhhhhhhhhhhhhhhhhhh...eeeeee..eeeeee...hhhhhhhhhhhhhhhhhh...---------------.eee.hhh...............hhhhhhhhhhhhhhhh.......hhhhhhh.............hhhhhhhhhhhhhhh..............eeeeeeee..eeeeeee.....eeeeeeee........hhhhhhhhhhhhhhhhhhh.....eeee...hhhhhhhhhhh........eee....hhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---------------------------------------L--A-------R-D-------V--R-AGAE---II-L----------GG--I-------IE-E--A-I------FY-IS---------------L--K------M-----M----AS---L-----------------D-C--I---CIA-----------------Y-WK--FF--------------------L-T--------------------------------------------I----------------------------------F--------------D----------------------------------------------------I------------------------------------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------D----------------------ENDR---VL------------SK-----------P-N--I----------------------------M------------------------------------------------T---H-C------------------------Y---------------------------------------------------------------------------------------------------------------------E----------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------------------------------------------------------GYGS----M-------------------------Q-R--M----------------------------T------------------------------------------------V---L-E---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------------------------------------------------------------N-N-----T------------------------------------------------------------------------------------------------------------------Q---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) -----------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------S---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (6)
             SAPs(SNPs) (7) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------V---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (7)
                    PROSITE ------------------------------------------RT_POL  PDB: B:44-234 UniProt: 631-821                                                                                                                                                         -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1rev B    2 ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLT---------------GYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ  428
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211   |     -       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       
                                                                                                                                                                                                                                               215             231                                                                                                                                                                                                     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (3, 9)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (4, 7)

Asymmetric/Biological Unit
(-)
Clan: RNase_H (288)
(-)
Clan: RdRP (210)

(-) Gene Ontology  (59, 59)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (POL_HV1H2 | P04585)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003887    DNA-directed DNA polymerase activity    Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1); the synthesis of DNA from deoxyribonucleotide triphosphates in the presence of a DNA template and a 3'hydroxyl group.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0004523    RNA-DNA hybrid ribonuclease activity    Catalysis of the endonucleolytic cleavage of RNA in RNA-DNA hybrids to 5'-phosphomonoesters.
    GO:0003964    RNA-directed DNA polymerase activity    Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1). Catalyzes RNA-template-directed extension of the 3'- end of a DNA strand by one deoxynucleotide at a time.
    GO:0004190    aspartic-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0004519    endonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by creating internal breaks.
    GO:0004533    exoribonuclease H activity    Catalysis of the exonucleolytic cleavage of RNA to 5'-phosphomonoester oligonucleotides in both 5' to 3' and 3' to 5' directions.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0008907    integrase activity    Catalysis of the integration of one segment of DNA into another.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0015074    DNA integration    The process in which a segment of DNA is incorporated into another, usually larger, DNA molecule such as a chromosome.
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0090503    RNA phosphodiester bond hydrolysis, exonucleolytic    The chemical reactions and pathways involving the hydrolysis of terminal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0006278    RNA-dependent DNA biosynthetic process    A DNA biosynthetic process that uses RNA as a template for RNA-dependent DNA polymerases (e.g. reverse transcriptase) that synthesize the new strand.
    GO:0030260    entry into host cell    The invasion by an organism of a cell of its host organism. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0075713    establishment of integrated proviral latency    A process by which the virus integrates into the host genome and establishes as a stable provirus or prophage.
    GO:0019064    fusion of virus membrane with host plasma membrane    Fusion of a viral membrane with the host cell membrane during viral entry. Results in release of the virion contents into the cytoplasm.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0039526    modulation by virus of host apoptotic process    Any process in which a virus modulates the frequency, rate or extent of apoptosis of infected host cells.
    GO:0051169    nuclear transport    The directed movement of substances into, out of, or within the nucleus.
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0039657    suppression by virus of host gene expression    Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of gene expression in the host organism. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Some protein processing events may be included when they are required to form an active form of a product from an inactive precursor form.
    GO:0019061    uncoating of virus    The process by which an incoming virus is disassembled in the host cell to release a replication-competent viral genome.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0019072    viral genome packaging    The encapsulation of the viral genome within the capsid.
    GO:0019058    viral life cycle    A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
    GO:0075732    viral penetration into host nucleus    The crossing by the virus of the host nuclear membrane, either as naked viral genome or for small viruses as an intact capsid.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019076    viral release from host cell    The dissemination of mature viral particles from the host cell, e.g. by cell lysis or the budding of virus particles from the cell membrane.
    GO:0019068    virion assembly    A late phase of the viral life cycle during which all the components necessary for the formation of a mature virion collect at a particular site in the cell and the basic structure of the virus particle is formed.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.
    GO:0044174    host cell endosome    A membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to host cell lysosomes for degradation.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0042025    host cell nucleus    A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0020002    host cell plasma membrane    The plasma membrane surrounding a host cell.
    GO:0072494    host multivesicular body    A late endosome in which regions of the limiting host cell endosomal membrane invaginate to form internal vesicles; host membrane proteins that enter the internal vesicles are sequestered from the host cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019013    viral nucleocapsid    The complete protein-nucleic acid complex that is the packaged form of the genome in a virus particle.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.
    GO:0055036    virion membrane    The lipid bilayer surrounding a virion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CSD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TB9  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:225 - Pro A:226   [ RasMol ]  
    Pro A:420 - Pro A:421   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1rev
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  POL_HV1H2 | P04585
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.49
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  POL_HV1H2 | P04585
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        POL_HV1H2 | P045851a30 1bv7 1bv9 1bve 1bvg 1bwa 1bwb 1c0t 1c0u 1c1b 1c1c 1dmp 1dtq 1dtt 1e6j 1ep4 1esk 1ex4 1exq 1fb7 1fk9 1fko 1fkp 1g6l 1hiv 1hvh 1hvr 1hwr 1hxb 1jkh 1jla 1jlb 1jlc 1jle 1jlf 1jlg 1jlq 1klm 1lv1 1lw0 1lw2 1lwc 1lwe 1lwf 1ncp 1o1w 1odw 1odx 1ody 1qbr 1qbs 1qbt 1qbu 1rt1 1rt2 1rt3 1rt4 1rt5 1rt6 1rt7 1rtd 1rth 1rti 1rtj 1s1t 1s1u 1s1v 1s1w 1s1x 1t05 1tam 1tkt 1tkx 1tkz 1tl1 1tl3 1vrt 1vru 2hnd 2hny 2hnz 2kod 2nph 2opp 2opq 2opr 2ops 2rf2 2rki 2whh 2wom 2won 2ynf 2yng 2ynh 2yni 3ao2 3c6t 3c6u 3di6 3dle 3dlg 3dm2 3dmj 3dok 3dol 3dox 3drp 3drr 3drs 3dya 3e01 3ffi 3i0r 3i0s 3kjv 3kk1 3kk2 3kk3 3kt2 3kt5 3lak 3lal 3lam 3lan 3lp0 3lp1 3lp2 3m8p 3m8q 3mec 3med 3mee 3meg 3mim 3n3i 3nbp 3phv 3qin 3qio 3qip 3t19 3t1a 3tam 4b3o 4b3p 4b3q 4i7f 4kse 4kv8 4ncg 4q1w 4q1x 4q1y 4q5m 4qlh 4u1h 4u1i 4u1j 4u7q 4u7v 5dgu 5dgw 5eu7 5hrn 5hrp 5hrr 5hrs 5im7 5j2m 5j2n 5j2p 5j2q 5k14 5t82

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1REV)