Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  TMRNA-SMPB: A JOURNEY TO THE CENTER OF THE BACTERIAL RIBOSOME
 
Authors :  F. Weis, P. Bron, E. Giudice, J. P. Rolland, D. Thomas, B. Felden, R. Gill
Date :  16 Apr 10  (Deposition) - 20 Oct 10  (Release) - 01 Dec 10  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  13.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Tmrna, Smpb, Ribosome, Trans-Translation, Ribosomal Protein-Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Weis, P. Bron, E. Giudice, J. P. Rolland, D. Thomas, B. Felden, R. Gillet
Tmrna-Smpb: A Journey To The Centre Of The Bacterial Ribosome.
Embo J. V. 29 3810 2010
PubMed-ID: 20953161  |  Reference-DOI: 10.1038/EMBOJ.2010.252

(-) Compounds

Molecule 1 - TMRNA
    ChainsA
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
 
Molecule 2 - SSRA-BINDING PROTEIN
    ChainsB
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3IYR)

(-) Sites  (0, 0)

(no "Site" information available for 3IYR)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3IYR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3IYR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3IYR)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SSRPPS01317 SsrA-binding protein.SSRP_THET822-34  1B:22-34

(-) Exons   (0, 0)

(no "Exon" information available for 3IYR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:RNA  Length:349
                                                                                                                                                                                                                                                                                                                                                                                             
                 3iyr A   1 GGGGGUGAAACGGUCUCGACGGGGGUCGCCGAGGGCGUGGCUGCGCGCCGAGGUGCGGGUGGCCUCGUAAAAACCCGCAACGGCAUAACUGCCAACACCAACUACGCUCUCGCGGCUUAAUGACCGCGACCUCGCCCGGUAGCCCUGCCGGGGGCUCACCGGAAGCGGGGACACAAACCCGGCUAGCCCGGGGCCACGCCCUCUAACCCCGGGCGAAGCUUGAAGGGGGCUCGCUCCUGGCCGCCCGUCCGCGGGCCAAGCCAGGAGGACACGCGAAACGCGGACUACGCGCGUAGAGGCCCGCCGUAGGGACCUUCGGACGGGGGUUCGACUCCCCCCACCUCCACCA 349
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340         

Chain B from PDB  Type:PROTEIN  Length:143
 aligned with SSRP_THET8 | Q8RR57 from UniProtKB/Swiss-Prot  Length:144

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
           SSRP_THET8     2 APVLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDGELYLENLYIAPYEKGSYANVDPRRKRKLLLHKHELRRLLGKVEQKGLTLVPLKIYFNERGYAKVLLGLARGKKAYEKRREDKKEAVRRALEEL 144
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeeeeeeee......hhhhhhhh.......ee........ee.........................hhhhhhhhhh.......eeeeeeeee.....eeeeeeeee...........hhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------SSRP         -------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3iyr B   2 APVLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDGELYLENLYIAPYEKGSYANVDPRRKRKLLLHKHELRRLLGKVEQKGLTLVPLKIYFNERGYAKVLLGLARGKKAYEKRREDKKEAVRRALEEL 144
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3IYR)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3IYR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3IYR)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain B   (SSRP_THET8 | Q8RR57)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
biological process
    GO:0070929    trans-translation    A translational elongation process in which transfer of a translating ribosome from one mRNA to another RNA template takes place. Trans-translation occurs during tmRNA release of stalled ribosomes.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3iyr)
 
  Sites
(no "Sites" information available for 3iyr)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3iyr)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3iyr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SSRP_THET8 | Q8RR57
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SSRP_THET8 | Q8RR57
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SSRP_THET8 | Q8RR571j1h 1wjx 2czj 3iyq 3iz4 4v6t 4v8q

(-) Related Entries Specified in the PDB File

3iyq