![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 3FR3) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 3FR3) |
Asymmetric Unit (1, 2) Biological Unit 1 (1, 4) |
(no "Exon" information available for 3FR3) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:201 aligned with GST_PLAFA | Q8MU52 from UniProtKB/Swiss-Prot Length:211 Alignment length:204 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193 203 GST_PLAFA 4 NIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRK 207 SCOP domains d3fr3a1 A:4-85 automated matches d3fr3a2 A:86-204 automated m atches SCOP domains CATH domains 3fr3A01 A:4-85 Glutaredoxin 3fr3A02 A:86-204 [code=1.20 .1050.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains Chain B from PDB Type:PROTEIN Length:198 aligned with GST_PLAFA | Q8MU52 from UniProtKB/Swiss-Prot Length:211 Alignment length:204 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193 203 GST_PLAFA 4 NIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRK 207 SCOP domains d3fr3b1 B:4-85 automated matches d3fr3b2 B:86-204 automated m atches SCOP domains CATH domains 3fr3B01 B:4-85 Glutaredoxin 3fr3B02 B:86-204 [code=1.20 .1050.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "Pfam Domain" information available for 3FR3) |
Asymmetric Unit(hide GO term definitions) Chain A,B (GST_PLAFA | Q8MU52)
|
|
|
|
|
|
|