Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE MARR-FAMILY REPRESSOR MEXR IN COMPLEX WITH ITS ANTIREPRESSOR ARMR
 
Authors :  M. S. Wilke, N. C. J. Strynadka
Date :  30 Aug 08  (Deposition) - 21 Oct 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Winged Helix, Helix-Turn-Helix, Protein-Peptide Complex, Dna-Binding, Repressor, Transcription, Transcription Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. S. Wilke, M. Heller, A. L. Creagh, C. A. Haynes, L. P. Mcintosh, K. Poole, N. C. J. Strynadka
The Crystal Structure Of Mexr From Pseudomonas Aeruginosa I Complex With Its Antirepressor Armr
Proc. Natl. Acad. Sci. Usa V. 105 14832 2008
PubMed-ID: 18812515  |  Reference-DOI: 10.1073/PNAS.0805489105

(-) Compounds

Molecule 1 - MULTIDRUG RESISTANCE OPERON REPRESSOR
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET41A
    Expression System StrainBL21 (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 1-142
    GeneMEXR, PA0424
    MutationYES
    Organism ScientificPSEUDOMONAS AERUGINOSA
    Organism Taxid287
    SynonymMEXR
 
Molecule 2 - 25-MER FRAGMENT OF PROTEIN ARMR
    ChainsC
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPTYB12
    Expression System StrainBL21 (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 29-53
    GenePA3719
    Organism ScientificPSEUDOMONAS AERUGINOSA
    Organism Taxid287

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3ECH)

(-) Sites  (0, 0)

(no "Site" information available for 3ECH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3ECH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3ECH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (5, 10)

Asymmetric/Biological Unit (5, 10)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_MEXR_PSEAE_001 *T69AMEXR_PSEAE  ---  ---A/BT69A
2UniProtVAR_MEXR_PSEAE_002 *R70WMEXR_PSEAE  ---  ---A/BR70W
3UniProtVAR_MEXR_PSEAE_003 *L95FMEXR_PSEAE  ---  ---A/BL95F
4UniProtVAR_MEXR_PSEAE_004 *V126EMEXR_PSEAE  ---  ---A/BV126E
5UniProtVAR_MEXR_PSEAE_005 *T130SMEXR_PSEAE  ---  ---A/BT130S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HTH_MARR_2PS50995 MarR-type HTH domain profile.MEXR_PSEAE6-140
 
  2A:6-140
B:6-140

(-) Exons   (0, 0)

(no "Exon" information available for 3ECH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:129
 aligned with MEXR_PSEAE | P52003 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:142
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140  
           MEXR_PSEAE     1 MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ 142
               SCOP domains d3echa_ A: MexR repressor                                                                                                                      SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh...hhhhhhhhhh---hhhhhhhhhhhhh..ee.----------..eehhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------AW------------------------F------------------------------E---S------------ SAPs(SNPs)
                    PROSITE -----HTH_MARR_2  PDB: A:6-140 UniProt: 6-140                                                                                                -- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ech A   1 MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMC---ALITRKIRELEGRNLVRR----------QLFLTDEGLAIHLHAELIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ 142
                                    10        20        30        40        50        60 |   |  70        80  |      -   |   100       110       120       130       140  
                                                                                        62  66               83         94                                                

Chain B from PDB  Type:PROTEIN  Length:135
 aligned with MEXR_PSEAE | P52003 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:141
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140 
           MEXR_PSEAE     1 MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAA 141
               SCOP domains d3echb_ B: MexR repressor                                                                                                                     SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh..eehhhhhhhh------hhhhhhhhhhh..eeeee.......eeeeehhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------AW------------------------F------------------------------E---S----------- SAPs(SNPs)
                    PROSITE -----HTH_MARR_2  PDB: B:6-140 UniProt: 6-140                                                                                                - PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ech B   1 MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQM------ITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHLHAELIMSRVHDELFAPLTPVEQATLVHLLDQCLAA 141
                                    10        20        30        40        50        60|      |70        80        90       100       110       120       130       140 
                                                                                       61     68                                                                         

Chain C from PDB  Type:PROTEIN  Length:24
 aligned with Q9HXS2_PSEAE | Q9HXS2 from UniProtKB/TrEMBL  Length:53

    Alignment length:24
                                    39        49    
         Q9HXS2_PSEAE    30 RDYTEQLRRAARRNAWDLYGEHFY  53
               SCOP domains ------------------------ SCOP domains
               CATH domains ------------------------ CATH domains
               Pfam domains ------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------ SAPs(SNPs)
                    PROSITE ------------------------ PROSITE
                 Transcript ------------------------ Transcript
                 3ech C  30 RDYTEQLRRAARRNAWDLYGEHFY  53
                                    39        49    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3ECH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3ECH)

(-) Gene Ontology  (11, 12)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (MEXR_PSEAE | P52003)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0044212    transcription regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
biological process
    GO:0050709    negative regulation of protein secretion    Any process that stops, prevents, or reduces the frequency, rate or extent of the controlled release of a protein from a cell.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0034763    negative regulation of transmembrane transport    Any process that stops, prevents, or reduces the frequency, rate or extent of the directed movement of a solute from one side of a membrane to the other.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain C   (Q9HXS2_PSEAE | Q9HXS2)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0032411    positive regulation of transporter activity    Any process that activates or increases the activity of a transporter.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3ech)
 
  Sites
(no "Sites" information available for 3ech)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3ech)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ech
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MEXR_PSEAE | P52003
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  Q9HXS2_PSEAE | Q9HXS2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MEXR_PSEAE | P52003
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q9HXS2_PSEAE | Q9HXS2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MEXR_PSEAE | P520031lnw 3mex 4zzl

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3ECH)