3BPO - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE IL13-IL4R-IL13RA TERNARY COMPLEX

Authors :   K. C. Garcia

Date :   18 Dec 07 (Deposition) - 05 Feb 08 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym./Biol. Unit : A,B,C

Keywords :   Il4, Il13, Il4R, Il13R, Cytokine, Receptor, Glycoprotein, Immune Response, Membrane, Phosphoprotein, Secreted, Transmembrane, Cytokine-Cytokine Receptor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. L. Laporte, Z. S. Juo, J. Vaclavikova, L. A. Colf, X. Qi, N. M. Heller, A. D. Keegan, K. C. Garcia
Molecular And Structural Basis Of Cytokine Receptor Pleiotropy In The Interleukin-4/13 System.
Cell(Cambridge, Mass. ) V. 132 259 2008
PubMed-ID: 18243101 | Reference-DOI: 10.1016/J.CELL.2007.12.030

Molecule 1 - INTERLEUKIN 13
	Chains	:	A
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Strain	:	SF9
	Expression System Taxid	:	7108
	Gene	:	IL13
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 2 - INTERLEUKIN-4 RECEPTOR ALPHA CHAIN
	Chains	:	B
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Strain	:	SF9
	Expression System Taxid	:	7108
	Fragment	:	EXTRACELLULAR DOMAIN, RESIDUES 27-227
	Gene	:	IL4R, 582J2.1, IL4RA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IL-4R-ALPHA, CD124 ANTIGEN, SOLUBLE INTERLEUKIN-4 RECEPTOR ALPHA CHAIN

Molecule 3 - INTERLEUKIN-13 RECEPTOR ALPHA-1 CHAIN
	Chains	:	C
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Strain	:	SF9
	Expression System Taxid	:	7108
	Fragment	:	EXTRACELLULAR DOMAIN, RESIDUES 29-342
	Gene	:	IL13RA1, IL13R, IL13RA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IL-13R-ALPHA-1, IL-13RA-1, CANCER/TESTIS ANTIGEN 19, CT19, CD213A1 ANTIGEN

		1	2	3
Asymmetric/Biological Unit	:	A	B	C

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 3)

No.	Name	Count	Type	Full Name
1	NAG	3	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASN B:103 , HOH B:918 , HOH B:920 , HOH B:927	BINDING SITE FOR RESIDUE NAG B 901
2	AC2	SOFTWARE	PRO A:3 , ASN B:184 , NAG B:912	BINDING SITE FOR RESIDUE NAG B 911
3	AC3	SOFTWARE	NAG B:911	BINDING SITE FOR RESIDUE NAG B 912

Asymmetric/Biological Unit

No.	Residues
1	A:57	-	A:29
2	A:71	-	A:45
3	B:19	-	B:9
4	B:59	-	B:29
5	B:61	-	B:49
6	C:102	-	C:62
7	C:117	-	C:95
8	C:144	-	C:134
9	C:185	-	C:173
10	C:296	-	C:282
11	C:320	-	C:257

Asymmetric/Biological Unit

No.	Residues
1	Ala A:41	-	Gly A:42
2	Glu C:56	-	Gly C:57

Asymmetric/Biological Unit (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_059302	I	75	F	IL4RA_HUMAN	Polymorphism	1805010	B	I	50	F
2	UniProt	VAR_059303	I	75	L	IL4RA_HUMAN	Polymorphism	1805010	B	I	50	L
3	UniProt	VAR_008034	I	75	V	IL4RA_HUMAN	Polymorphism	1805010	B	I	50	V
4	UniProt	VAR_010037	R	144	Q	IL13_HUMAN	Polymorphism	20541	A	Q	111	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (4, 7)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN3	PS50853	Fibronectin type-III domain profile.	I13R1_HUMAN	34-123 227-339 128-226	3	C:34-123 C:227-339 C:128-226
1	FN3	PS50853	Fibronectin type-III domain profile.	IL4RA_HUMAN	125-224	1	B:100-196
2	INTERLEUKIN_4_13	PS00838	Interleukins -4 and -13 signature.	IL13_HUMAN	43-70	1	A:10-37
3	HEMATOPO_REC_S_F2	PS01356	Short hematopoietin receptor family 2 signature.	I13R1_HUMAN	142-173	1	C:142-173
4	HEMATOPO_REC_S_F1	PS01355	Short hematopoietin receptor family 1 signature.	IL4RA_HUMAN	191-221	1	B:166-196

Asymmetric/Biological Unit (13, 13)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000371666	1a	ENSE00001455886	X:117861535-117861689	155	I13R1_HUMAN	1-30	30	0	-	-
1.2	ENST00000371666	2	ENSE00001125702	X:117874980-117875119	140	I13R1_HUMAN	30-76	47	1	C:32-76 (gaps)	45
1.3	ENST00000371666	3	ENSE00001125697	X:117880917-117881055	139	I13R1_HUMAN	77-123	47	1	C:77-123 (gaps)	47
1.4a	ENST00000371666	4a	ENSE00001125692	X:117883621-117883741	121	I13R1_HUMAN	123-163	41	1	C:123-163 (gaps)	41
1.5	ENST00000371666	5	ENSE00001125685	X:117892018-117892205	188	I13R1_HUMAN	163-226	64	1	C:163-226 (gaps)	64
1.7a	ENST00000371666	7a	ENSE00000899851	X:117895101-117895252	152	I13R1_HUMAN	226-276	51	1	C:226-276 (gaps)	51
1.8	ENST00000371666	8	ENSE00000899852	X:117900493-117900540	48	I13R1_HUMAN	277-292	16	1	C:277-292	16
1.9b	ENST00000371666	9b	ENSE00000899853	X:117900807-117900939	133	I13R1_HUMAN	293-337	45	1	C:293-337	45
1.11	ENST00000371666	11	ENSE00000899854	X:117907842-117907938	97	I13R1_HUMAN	337-369	33	1	C:337-342	6
1.12	ENST00000371666	12	ENSE00000899855	X:117910390-117910474	85	I13R1_HUMAN	369-397	29	0	-	-
1.13b	ENST00000371666	13b	ENSE00001896146	X:117925725-117928502	2778	I13R1_HUMAN	398-427	30	0	-	-

2.1c	ENST00000395762	1c	ENSE00001522740	chr16:27325252-27325341	90	IL4RA_HUMAN	-	0	0	-	-
2.2	ENST00000395762	2	ENSE00001522738	chr16:27341387-27341519	133	IL4RA_HUMAN	-	0	0	-	-
2.3b	ENST00000395762	3b	ENSE00001522737	chr16:27351507-27351594	88	IL4RA_HUMAN	1-24	24	1	B:-1--1	1
2.5	ENST00000395762	5	ENSE00000681600	chr16:27353442-27353580	139	IL4RA_HUMAN	24-70	47	1	B:-1-45	47
2.6	ENST00000395762	6	ENSE00000411237	chr16:27356190-27356341	152	IL4RA_HUMAN	70-121	52	1	B:45-96	52
2.7	ENST00000395762	7	ENSE00000681616	chr16:27357788-27357939	152	IL4RA_HUMAN	121-171	51	1	B:96-146	51
2.8	ENST00000395762	8	ENSE00000681622	chr16:27363861-27364017	157	IL4RA_HUMAN	172-224	53	1	B:147-196	50
2.10	ENST00000395762	10	ENSE00000681627	chr16:27367129-27367228	100	IL4RA_HUMAN	224-257	34	0	-	-
2.11	ENST00000395762	11	ENSE00000681633	chr16:27370237-27370315	79	IL4RA_HUMAN	257-283	27	0	-	-
2.12	ENST00000395762	12	ENSE00000830176	chr16:27372087-27372136	50	IL4RA_HUMAN	284-300	17	0	-	-
2.13b	ENST00000395762	13b	ENSE00001522736	chr16:27373573-27376099	2527	IL4RA_HUMAN	300-825	526	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:98
 aligned with IL13_HUMAN | P35225 from UniProtKB/Swiss-Prot  Length:146

    Alignment length:111
                                    44        54        64        74        84        94       104       114       124       134       144 
           IL13_HUMAN    35 GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRF 145
               SCOP domains d3bpoa_ A: Interleuki   n-13 (IL-13)                                                                            SCOP domains
               CATH domains 3bpoA00 A:2-112  [cod   e=1.20.1250.1  0, no name defined]                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.---..hhhhh.ee...--...hhhhhhh......hhhhhhhhhhhh.....--------.......eehhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------Q- SAPs(SNPs)
                PROSITE (2) --------INTERLEUKIN_4_13            --------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 3bpo A   2 GPVPPSTALRELIEELVNITQ---APLCNGSMVWSIN--AGMYCAALESLINVSGCSAIEKTQRMLSGFCPH--------SLHVRDTKIEVAQFVKDLLLHLKKLFREGQF 112
                                    11        21|   |   31      | 41        51        61        71 |       -|       91       101       111 
                                               22  26          38 41                              73       82

Chain A from PDB  Type:PROTEIN  Length:98
 aligned with Q4VB50_HUMAN | Q4VB50 from UniProtKB/TrEMBL  Length:145

    Alignment length:111
                                    30        40        50        60        70        80        90       100       110       120       130 
         Q4VB50_HUMAN    21 GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQF 131
               SCOP domains d3bpoa_ A: Interleuki   n-13 (IL-13)                                                                            SCOP domains
               CATH domains 3bpoA00 A:2-112  [cod   e=1.20.1250.1  0, no name defined]                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.---..hhhhh.ee...--...hhhhhhh......hhhhhhhhhhhh.....--------.......eehhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------Q- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 3bpo A   2 GPVPPSTALRELIEELVNITQ---APLCNGSMVWSIN--AGMYCAALESLINVSGCSAIEKTQRMLSGFCPH--------SLHVRDTKIEVAQFVKDLLLHLKKLFREGQF 112
                                    11        21|   |   31      | 41        51        61        71 |       -|       91       101       111 
                                               22  26          38 41                              73       82

Chain B from PDB  Type:PROTEIN  Length:198
 aligned with IL4RA_HUMAN | P24394 from UniProtKB/Swiss-Prot  Length:825

    Alignment length:198
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213        
          IL4RA_HUMAN    24 GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKW 221
               SCOP domains d3bpob1 B:-1-96 automated matches                                                                 d3bpob2 B:97-196 automated matches                                                                   SCOP domains
               CATH domains 3bpoB01 B:-1-96 Immunoglobulins                                                                   3bpoB02 B:97-196 Immunoglobulins                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeeeee....eeeeeeee....hhhhheeeeeee......eeee..ee....eeeeeee.........eeeeeee......eeee...........eeeeeeee...eeeeeee.......hhhh.eeeeeeeee......eeeeee.....eeeee.hhh.....eeeeeeeee.............eee Sec.struct. author
             SAPs(SNPs) (1) ---------------------------------------------------F-------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------L-------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------------------------------------------------V-------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                PROSITE (2) -----------------------------------------------------------------------------------------------------FN3  PDB: B:100-196 UniProt: 125-224                                                              PROSITE (2)
                PROSITE (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_S_F1               PROSITE (3)
           Transcript 2 (1) 2---------------------------------------------Exon 2.6  PDB: B:45-96 UniProt: 70-121              --------------------------------------------------Exon 2.8  PDB: B:147-196 UniProt: 172-224          Transcript 2 (1)
           Transcript 2 (2) Exon 2.5  PDB: B:-1-45 UniProt: 24-70          --------------------------------------------------Exon 2.7  PDB: B:96-146 UniProt: 121-171           -------------------------------------------------- Transcript 2 (2)
                 3bpo B  -1 DPFKVLQEPTCVSDYMSISTCEWKMNGPTQCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADQYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTQVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYQVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKW 196
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188

Chain C from PDB  Type:PROTEIN  Length:286
 aligned with I13R1_HUMAN | P78552 from UniProtKB/Swiss-Prot  Length:427

    Alignment length:311
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341 
          I13R1_HUMAN    32 QPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNS 342
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee...eeeeeee............eee...--...eee...eeeee......eeeeeee..---------..eeeee.....-.....eeeeeeee...eeeeeee...---....eeeeeee......ee...eeee..eeeeeee...--------..eeeeeee.......eeeee.....ee....eeeeeeee..eeeeeee.....hhh.eeeeeeee.--...eeeeee................eeeeee........eeeeeeeee.................eee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --FN3  PDB: C:34-123 UniProt: 34-123                                                        ----FN3  PDB: C:128-226 UniProt: 128-226                                                               FN3  PDB: C:227-339 UniProt: 227-339                                                                             --- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------HEMATOPO_REC_S_F2  PDB: C:142-17------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) Exon 1.2  PDB: C:32-76 (gaps) UniProt: 30-76 Exon 1.3  PDB: C:77-123 (gaps) UniProt: 77-123 ---------------------------------------Exon 1.5  PDB: C:163-226 (gaps) UniProt: 163-226                --------------------------------------------------Exon 1.8        --------------------------------------------1.11   Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------Exon 1.4a  PDB: C:123-163 (gaps)         --------------------------------------------------------------Exon 1.7a  PDB: C:226-276 (gaps) UniProt: 226-276  ----------------Exon 1.9b  PDB: C:293-337 UniProt: 293-337   ----- Transcript 1 (2)
                 3bpo C  32 QPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFG--QDKKIAPETRRSIEVPLNERICLQVGSQC---------ILVEKCISPPEG-PESAVTELQCIWHNLSYMKCSWLPGR---PDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTK--------HSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNN--TETHNVFYVQEAKCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNS 342
                                    41        51        61        71  |     81        91       101|        -|      121 | |   131       141        |-  |    161       171       181       191       201       211       221       231       241       251       261    |  271       281       291       301       311       321       331       341 
                                                                  71 74                         102       112        123 |                      150 154                                  191      200                                                               266  |                                                                         
                                                                                                                       125                                                                                                                                             269

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: 4-helical cytokines (168)

Superfamily: 4-helical cytokines (168)

Family: Short-chain cytokines (78)

Protein domain: Interleukin-13 (IL-13) (9)

Human (Homo sapiens) [TaxId: 9606] (9)

d3bpoa_

Class: All beta proteins (24004)

Fold: Immunoglobulin-like beta-sandwich (7299)

Superfamily: Fibronectin type III (212)

Family: Fibronectin type III (180)

Protein domain: automated matches (23)

Human (Homo sapiens) [TaxId: 9606] (23)

2a	d3bpob1	B:-1-96
2b	d3bpob2	B:97-196

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Growth Hormone; Chain: A; (136)

Homologous Superfamily: [code=1.20.1250.10, no name defined] (130)

Human (Homo sapiens) (110)

3bpoA00

A:2-112

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Immunoglobulins (2282)

Human (Homo sapiens) (912)

2a	3bpoB01	B:-1-96
2b	3bpoB02	B:97-196

(no "Pfam Domain" information available for 3BPO)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (IL13_HUMAN | P35225)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0005126	cytokine receptor binding	Interacting selectively and non-covalently with a cytokine receptor.
	GO:0005144	interleukin-13 receptor binding	Interacting selectively and non-covalently with the interleukin-13 receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0071345	cellular response to cytokine stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0071260	cellular response to mechanical stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0001774	microglial cell activation	The change in morphology and behavior of a microglial cell resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0006928	movement of cell or subcellular component	The directed, self-propelled movement of a cell or subcellular component without the involvement of an external agent such as a transporter or a pore.
	GO:0033861	negative regulation of NAD(P)H oxidase activity	Any process that stops or reduces the activity of the enzyme NAD(P)H oxidase.
	GO:1903660	negative regulation of complement-dependent cytotoxicity	Any process that stops, prevents or reduces the frequency, rate or extent of complement-dependent cytotoxicity.
	GO:2000352	negative regulation of endothelial cell apoptotic process	Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
	GO:1901247	negative regulation of lung ciliated cell differentiation	Any process that stops, prevents or reduces the frequency, rate or extent of lung ciliated cell differentiation.
	GO:1901215	negative regulation of neuron death	Any process that stops, prevents or reduces the frequency, rate or extent of neuron death.
	GO:0071635	negative regulation of transforming growth factor beta production	Any process that stops, prevents, or reduces the frequency, rate, or extent of production of transforming growth factor-beta.
	GO:0030890	positive regulation of B cell proliferation	Any process that activates or increases the rate or extent of B cell proliferation.
	GO:0032723	positive regulation of connective tissue growth factor production	Any process that activates or increases the frequency, rate, or extent of connective tissue growth factor production.
	GO:0002639	positive regulation of immunoglobulin production	Any process that activates or increases the frequency, rate, or extent of immunoglobulin production.
	GO:0043270	positive regulation of ion transport	Any process that activates or increases the frequency, rate or extent of the directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:1901251	positive regulation of lung goblet cell differentiation	Any process that activates or increases the frequency, rate or extent of lung goblet cell differentiation.
	GO:0043032	positive regulation of macrophage activation	Any process that stimulates, induces or increases the rate of macrophage activation.
	GO:0043306	positive regulation of mast cell degranulation	Any process that activates or increases the frequency, rate or extent of mast cell degranulation.
	GO:2000231	positive regulation of pancreatic stellate cell proliferation	Any process that activates or increases the frequency, rate or extent of pancreatic stellate cell proliferation.
	GO:0050714	positive regulation of protein secretion	Any process that activates or increases the frequency, rate or extent of the controlled release of a protein from a cell.
	GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	Any process that activates or increases the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria.
	GO:0048661	positive regulation of smooth muscle cell proliferation	Any process that activates or increases the rate or extent of smooth muscle cell proliferation.
	GO:0010155	regulation of proton transport	Any process that modulates the frequency, rate or extent of proton transport into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0009612	response to mechanical stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
	GO:0035094	response to nicotine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nicotine stimulus.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain A (Q4VB50_HUMAN | Q4VB50)

molecular function
	GO:0005126	cytokine receptor binding	Interacting selectively and non-covalently with a cytokine receptor.
biological process
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:1903660	negative regulation of complement-dependent cytotoxicity	Any process that stops, prevents or reduces the frequency, rate or extent of complement-dependent cytotoxicity.
	GO:2000352	negative regulation of endothelial cell apoptotic process	Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain B (IL4RA_HUMAN | P24394)

molecular function
	GO:0004896	cytokine receptor activity	Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0004913	interleukin-4 receptor activity	Combining with interleukin-4 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005057	signal transducer activity, downstream of receptor	Conveys a signal from an upstream receptor or intracellular signal transducer, converting the signal into a form where it can ultimately trigger a change in the state or activity of a cell.
biological process
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0042832	defense response to protozoan	Reactions triggered in response to the presence of a protozoan that act to protect the cell or organism.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0016064	immunoglobulin mediated immune response	An immune response mediated by immunoglobulins, whether cell-bound or in solution.
	GO:0035771	interleukin-4-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-4 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0045626	negative regulation of T-helper 1 cell differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of T-helper 1 cell differentiation.
	GO:0030728	ovulation	The release of a mature ovum/oocyte from an ovary.
	GO:0045630	positive regulation of T-helper 2 cell differentiation	Any process that activates or increases the frequency, rate or extent of T-helper 2 cell differentiation.
	GO:0090197	positive regulation of chemokine secretion	Any process that increases the rate, frequency or extent of chemokine secretion, the regulated release of chemokines from a cell.
	GO:0002639	positive regulation of immunoglobulin production	Any process that activates or increases the frequency, rate, or extent of immunoglobulin production.
	GO:0043032	positive regulation of macrophage activation	Any process that stimulates, induces or increases the rate of macrophage activation.
	GO:0043306	positive regulation of mast cell degranulation	Any process that activates or increases the frequency, rate or extent of mast cell degranulation.
	GO:1901741	positive regulation of myoblast fusion	Any process that activates or increases the frequency, rate or extent of myoblast fusion.
	GO:0002532	production of molecular mediator involved in inflammatory response	The synthesis or release of any molecular mediator of the inflammatory response following an inflammatory stimulus, resulting in an increase in its intracellular or extracellular levels.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:0043627	response to estrogen	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by an estrogen, C18 steroid hormones that can stimulate the development of female sexual characteristics.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

Chain C (I13R1_HUMAN | P78552)

molecular function
	GO:0004896	cytokine receptor activity	Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005898	interleukin-13 receptor complex	A protein complex that binds interleukin-13; consists of two chains, interleukin-13 receptor alpha1 chain and interleukin-4 receptor alpha chain.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:41 - Gly A:42	[ RasMol ]
		Glu C:56 - Gly C:57	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3bpo
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	I13R1_HUMAN \| P78552
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	IL13_HUMAN \| P35225
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	IL4RA_HUMAN \| P24394
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q4VB50_HUMAN \| Q4VB50
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	I13R1_HUMAN \| P78552
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	IL13_HUMAN \| P35225
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	IL4RA_HUMAN \| P24394
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q4VB50_HUMAN \| Q4VB50
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	I13R1_HUMAN \| P78552	:	3bpn 4hwb 5e4e
	IL13_HUMAN \| P35225	:	1ga3 1ijz 1ik0 1j9u 3g6d 3itr 3its 3l5w 3l5x 3lb6 4i77 4ps4 5e4e 5l6y
	IL4RA_HUMAN \| P24394	:	1iar 1ill 1irs 1ite 3bpl 3bpn 5e4e

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 3)

Sites (3, 3)

SS Bonds (11, 11)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 4)

PROSITE Motifs (4, 7)

Exons (13, 13)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 3)

CATH Domains (2, 3)

Pfam Domains (0, 0)

Gene Ontology (61, 80)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File