Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ENGINEERED INTERLEUKIN-13 BOUND TO RECEPTOR
 
Authors :  I. Moraga, C. Thomas, K. M. Jude, K. C. Garcia
Date :  05 Oct 15  (Deposition) - 02 Dec 15  (Release) - 02 Dec 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Agonist-Receptor Complex, Protein Engineering, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  I. Moraga, D. Richter, S. Wilmes, H. Winkelmann, K. Jude, C. Thomas, M. M. Suhoski, E. G. Engleman, J. Piehler, K. C. Garcia
Instructive Roles For Cytokine-Receptor Binding Parameters In Determining Signaling And Functional Potency.
Sci. Signal. V. 8 Ra114 2015
PubMed-ID: 26554818  |  Reference-DOI: 10.1126/SCISIGNAL.AAB2677

(-) Compounds

Molecule 1 - INTERLEUKIN-13
    Chains: A
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Taxid: 7111
    Fragment: UNP RESIDUES 34-146
    Gene: IL13, NC30
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: IL-13
 
Molecule 2 - INTERLEUKIN-4 RECEPTOR SUBUNIT ALPHA
    Chains: B
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Taxid: 7111
    Fragment: UNP RESIDUES 26-228
    Gene: IL4R, IL4RA, 582J2.1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: IL-4RA
 
Molecule 3 - INTERLEUKIN-13 RECEPTOR SUBUNIT ALPHA-1
    Chains: C
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Taxid: 7111
    Fragment: UNP RESIDUES 23-340
    Gene: IL13RA1, IL13R, IL13RA
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: IL-13RA1,CANCER/TESTIS ANTIGEN 19,CT19

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 9)

Asymmetric/Biological Unit (2, 9)
No.NameCountTypeFull Name
1NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
2SO47Ligand/IonSULFATE ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:84 , VAL A:85binding site for residue SO4 A 201
2AC2SOFTWAREGLU A:49 , HIS A:73 , HIS A:84binding site for residue SO4 A 202
3AC3SOFTWARETRP A:35 , ASN A:53 , GLY A:78 , GLN A:79 , PHE A:80 , SER A:81binding site for residue SO4 A 203
4AC4SOFTWARESER A:36 , ASN A:38 , SER A:87 , SER A:88 , LYS C:77binding site for residue SO4 A 204
5AC5SOFTWAREASN C:157 , ASN C:209 , ALA C:210 , LYS C:338binding site for residue SO4 C 401
6AC6SOFTWAREASP C:229 , GLN C:251binding site for residue SO4 C 402
7AC7SOFTWAREHIS C:232 , GLN C:332binding site for residue SO4 C 403
8AC8SOFTWAREASN B:73 , SER B:89binding site for Mono-Saccharide NAG B 302 bound to ASN B 73
9AC9SOFTWAREASN B:151 , TRP B:179 , MET C:298binding site for Mono-Saccharide NAG B 301 bound to ASN B 151

(-) SS Bonds  (11, 11)

Asymmetric/Biological Unit
No.Residues
1A:29 -A:57
2A:45 -A:71
3B:9 -B:19
4B:29 -B:59
5B:49 -B:61
6C:62 -C:102
7C:95 -C:117
8C:134 -C:144
9C:173 -C:185
10C:257 -C:320
11C:282 -C:296

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5E4E)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5E4E)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5E4E)

(-) Exons   (0, 0)

(no "Exon" information available for 5E4E)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:111
                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhh...hhhhh.eee......hhhhhhhhhhh.......hhhhhhhhh..........hhhhhh....eeehhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 5e4e A   1 PGPVPPSTAVRELIEELINITQNAPLCNGSMVWSINRTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRSSKIEVAQFVKDLLFHLRTLFREGQFN 113
                                    10        20  ||    32        42        52        62        72        82        92       102       112 
                                                 23|                                                                                       
                                                  26                                                                                       


Chain B from PDB  Type:PROTEIN  Length:183
                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee....eeeeeee.........eeeeeee.......eee..ee....eeeeeee.........eeeeeee..eeeeeeee...........eeeee....eeeeee.......hhhh.eeeeeeee.....eeeee.....eeee....eeeeeeeee.............eee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5e4e B   1 MKVLQEPTCVSDYMSISTCEWKMGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSPADFRIYNVTYLEPSLRIAASSYRARVRAWAQCYNTTWSEWSPSTKW 196
                                    10        20  ||    31        41        51        61        71        81        91       101     ||114       124       134     ||147       157      |173       183       193   
                                                 23|                                                                               107|                          140|                 164|                         
                                                  25                                                                                111                           144                  171                         


Chain C from PDB  Type:PROTEIN  Length:303
                                                                                                                                                                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee...eeeeeee...........eeeeee...eeeeee...eeeee......eeeeeeee...........eeeeee...........eeeeeeee...eeeeeee..........eeeeee.......eee..eeee..eeeeeee......eeeeeeee.......eeeeee....ee....eeeeeeee..eeeeeee.....hhh.eeeeeeeee.....eeeeee......hhhhh.....eeeeee........eeeeeeeee.................eee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5e4e C  32 QPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKR 340
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191|      207       217       227       237       247       257       267       277       287       297       307       317       327       337   
                                                                                                                                                                                         191|                                                                                                                                              
                                                                                                                                                                                          198
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5E4E)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5E4E)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5E4E)

(-) Gene Ontology  (61, 75)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5e4e)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5e4e
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  I13R1_HUMAN | P78552
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  IL13_HUMAN | P35225
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  IL4RA_HUMAN | P24394
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  I13R1_HUMAN | P78552
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  IL13_HUMAN | P35225
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  IL4RA_HUMAN | P24394
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        I13R1_HUMAN | P78552: 3bpn 3bpo 4hwb
        IL13_HUMAN | P35225: 1ga3 1ijz 1ik0 1j9u 3bpo 3g6d 3itr 3its 3l5w 3l5x 3lb6 4i77 4ps4 5l6y
        IL4RA_HUMAN | P24394: 1iar 1ill 1irs 1ite 3bpl 3bpn 3bpo

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5E4E)