3B5N - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   STRUCTURE OF THE YEAST PLASMA MEMBRANE SNARE COMPLEX

Authors :   P. Strop, A. T. Brunger

Date :   26 Oct 07 (Deposition) - 20 Nov 07 (Release) - 19 May 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.60

Chains :   Asym. Unit : A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: E,F,G,H  (1x)
Biol. Unit 3: I,J,K,L  (1x)

Keywords :   Snare Complex, Syntaxin, Synaptobrevin, Snap-25, Sso1P, Snc1P, Sec9P, Sec9, Sso1, Snc1, Coiled Coil, Lipoprotein, Membrane, Palmitate, Transmembrane, Ubl Conjugation, Phosphorylation, Protein Transport, Transport, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Strop, S. E. Kaiser, M. Vrljic, A. T. Brunger
The Structure Of The Yeast Plasma Membrane Snare Complex Reveals Destabilizing Water-Filled Cavities.
J. Biol. Chem. V. 283 1113 2008
PubMed-ID: 17956869 | Reference-DOI: 10.1074/JBC.M707912200
(for further references see the PDB file header)

Molecule 1 - SYNAPTOBREVIN HOMOLOG 1
	Chains	:	A, E, I
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	RESIDUES 27-86
	Gene	:	SNC1
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932

Molecule 2 - PROTEIN SSO1
	Chains	:	B, F, J
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	RESIDUES 189-257
	Gene	:	SSO1
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932

Molecule 3 - PROTEIN TRANSPORT PROTEIN SEC9
	Chains	:	C, G, K
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	RESIDUES 433-499
	Gene	:	SEC9, HSS7
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932

Molecule 4 - PROTEIN TRANSPORT PROTEIN SEC9
	Chains	:	D, H, L
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	RESIDUES 589-650
	Gene	:	SEC9, HSS7
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932

		1	2	3	4	5	6	7	8	9	10	11	12
Asymmetric Unit	:	A	B	C	D	E	F	G	H	I	J	K	L
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (1x)	:					E	F	G	H
Biological Unit 3 (1x)	:									I	J	K	L

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3B5N)

(no "Site" information available for 3B5N)

(no "SS Bond" information available for 3B5N)

(no "Cis Peptide Bond" information available for 3B5N)

(no "SAP(SNP)/Variant" information available for 3B5N)

Asymmetric Unit (4, 15)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	V_SNARE	PS50892	v-SNARE coiled-coil homology domain profile.	SNC1_YEAST	28-88	1	A:28-86
2	SYNAPTOBREVIN	PS00417	Synaptobrevin signature.	SNC1_YEAST	46-65	3	A:46-65 E:46-65 I:46-65
3	T_SNARE	PS50192	t-SNARE coiled-coil homology domain profile.	SSO1_YEAST	190-252	2	B:190-252 F:190-252
3	T_SNARE	PS50192	t-SNARE coiled-coil homology domain profile.	SEC9_YEAST	434-496 588-650	6	C:434-496 G:434-496 K:434-496 D:589-650 H:589-650 L:589-649
4	SYNTAXIN	PS00914	Syntaxin / epimorphin family signature.	SSO1_YEAST	196-235	3	B:196-235 F:196-235 J:196-235

Biological Unit 1 (4, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	V_SNARE	PS50892	v-SNARE coiled-coil homology domain profile.	SNC1_YEAST	28-88	1	A:28-86
2	SYNAPTOBREVIN	PS00417	Synaptobrevin signature.	SNC1_YEAST	46-65	1	A:46-65 - -
3	T_SNARE	PS50192	t-SNARE coiled-coil homology domain profile.	SSO1_YEAST	190-252	1	B:190-252 -
3	T_SNARE	PS50192	t-SNARE coiled-coil homology domain profile.	SEC9_YEAST	434-496 588-650	2	C:434-496 - - D:589-650 - -
4	SYNTAXIN	PS00914	Syntaxin / epimorphin family signature.	SSO1_YEAST	196-235	1	B:196-235 - -

Biological Unit 2 (3, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	V_SNARE	PS50892	v-SNARE coiled-coil homology domain profile.	SNC1_YEAST	28-88	0	-
2	SYNAPTOBREVIN	PS00417	Synaptobrevin signature.	SNC1_YEAST	46-65	1	- E:46-65 -
3	T_SNARE	PS50192	t-SNARE coiled-coil homology domain profile.	SSO1_YEAST	190-252	1	- F:190-252
3	T_SNARE	PS50192	t-SNARE coiled-coil homology domain profile.	SEC9_YEAST	434-496 588-650	2	- G:434-496 - - H:589-650 -
4	SYNTAXIN	PS00914	Syntaxin / epimorphin family signature.	SSO1_YEAST	196-235	1	- F:196-235 -

Biological Unit 3 (3, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	V_SNARE	PS50892	v-SNARE coiled-coil homology domain profile.	SNC1_YEAST	28-88	0	-
2	SYNAPTOBREVIN	PS00417	Synaptobrevin signature.	SNC1_YEAST	46-65	1	- - I:46-65
3	T_SNARE	PS50192	t-SNARE coiled-coil homology domain profile.	SSO1_YEAST	190-252	0	- -
3	T_SNARE	PS50192	t-SNARE coiled-coil homology domain profile.	SEC9_YEAST	434-496 588-650	2	- - K:434-496 - - L:589-649
4	SYNTAXIN	PS00914	Syntaxin / epimorphin family signature.	SSO1_YEAST	196-235	1	- - J:196-235

Asymmetric Unit (4, 15)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	YAL030W	1	YAL030W.1	I:87287-87388	102	SNC1_YEAST	1-34	34	3	A:26-34 E:29-34 I:29-34	9 6 6
1.2	YAL030W	2	YAL030W.2	I:87502-87753	252	SNC1_YEAST	35-117	83	3	A:35-86 E:35-86 I:35-86	52 52 52

2.1	YGR009C	1	YGR009C.1	VII:511006-509051	1956	SEC9_YEAST	1-651	651	6	C:431-500 D:587-650 G:431-499 H:588-650 K:434-498 L:588-649	70 64 69 63 65 62

3.1	YPL232W	1	YPL232W.1	XVI:107275-108147	873	SSO1_YEAST	1-290	290	3	B:189-257 F:189-256 J:191-254	69 68 64

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:61
 aligned with SNC1_YEAST | P31109 from UniProtKB/Swiss-Prot  Length:117

    Alignment length:61
                                    35        45        55        65        75        85 
           SNC1_YEAST    26 KSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMW  86
               SCOP domains d3b5na_ A: Synaptobrevin                                      SCOP domains
               CATH domains 3b5nA00 A:26-86  [code=1.20.5.110, no name defined]           CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --V_SNARE  PDB: A:28-86 UniProt: 28-88                        PROSITE (1)
                PROSITE (2) --------------------SYNAPTOBREVIN       --------------------- PROSITE (2)
               Transcript 1 Exon 1.1 Exon 1.2  PDB: A:35-86 UniProt: 35-117 [INCOMPLETE]  Transcript 1
                 3b5n A  26 GSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMW  86
                                    35        45        55        65        75        85

Chain B from PDB  Type:PROTEIN  Length:69
 aligned with SSO1_YEAST | P32867 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:69
                                   198       208       218       228       238       248         
           SSO1_YEAST   189 ALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSAR 257
               SCOP domains d3b5nb_ B: Syntaxin 1A                                                SCOP domains
               CATH domains 3b5nB00 B:189-257  [code=1.20.5.110, no name defined]                 CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -T_SNARE  PDB: B:190-252 UniProt: 190-252                       ----- PROSITE (1)
                PROSITE (2) -------SYNTAXIN  PDB: B:196-235                ---------------------- PROSITE (2)
               Transcript 3 Exon 3.1  PDB: B:189-257 UniProt: 1-290 [INCOMPLETE]                  Transcript 3
                 3b5n B 189 ALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSAR 257
                                   198       208       218       228       238       248

Chain C from PDB  Type:PROTEIN  Length:70
 aligned with SEC9_YEAST | P40357 from UniProtKB/Swiss-Prot  Length:651

    Alignment length:70
                                   440       450       460       470       480       490       500
           SEC9_YEAST   431 QEIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKKLN 500
               SCOP domains d3b5nc_ C: automated matches                                           SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---T_SNARE  PDB: C:434-496 UniProt: 434-496                       ---- PROSITE
               Transcript 2 Exon 2.1  PDB: C:431-500 UniProt: 1-651 [INCOMPLETE]                   Transcript 2
                 3b5n C 431 GSIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKKLQ 500
                                   440       450       460       470       480       490       500

Chain D from PDB  Type:PROTEIN  Length:64
 aligned with SEC9_YEAST | P40357 from UniProtKB/Swiss-Prot  Length:651

    Alignment length:64
                                   596       606       616       626       636       646    
           SEC9_YEAST   587 DDEMELEIDRNLDQIQQVSNRLKKMALTTGKELDSQQKRLNNIEESTDDLDINLHMNTNRLAGI 650
               SCOP domains ---------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -T_SNARE  PDB: D:589-650 UniProt: 588-650                        PROSITE
               Transcript 2 Exon 2.1  PDB: D:587-650 UniProt: 1-651 [INCOMPLETE]             Transcript 2
                 3b5n D 587 GSEMELEIDRNLDQIQQVSNRLKKMALTTGKELDSQQKRLNNIEESTDDLDINLHMNTNRLAGI 650
                                   596       606       616       626       636       646

Chain E from PDB  Type:PROTEIN  Length:58
 aligned with SNC1_YEAST | P31109 from UniProtKB/Swiss-Prot  Length:117

    Alignment length:58
                                    38        48        58        68        78        
           SNC1_YEAST    29 TAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMW  86
               SCOP domains d3b5ne_ E: Synaptobrevin                                   SCOP domains
               CATH domains 3b5nE00 E:29-86  [code=1.20.5.110, no name defined]        CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) V_SNARE  PDB: - UniProt: 28-88                             PROSITE (1)
                PROSITE (2) -----------------SYNAPTOBREVIN       --------------------- PROSITE (2)
               Transcript 1 1.1   Exon 1.2  PDB: E:35-86 UniProt: 35-117 [INCOMPLETE]  Transcript 1
                 3b5n E  29 TAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMW  86
                                    38        48        58        68        78

Chain F from PDB  Type:PROTEIN  Length:68
 aligned with SSO1_YEAST | P32867 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:68
                                   198       208       218       228       238       248        
           SSO1_YEAST   189 ALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSA 256
               SCOP domains d3b5nf_ F: Syntaxin 1A                                               SCOP domains
               CATH domains 3b5nF00 F:189-256  [code=1.20.5.110, no name defined]                CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -T_SNARE  PDB: F:190-252 UniProt: 190-252                       ---- PROSITE (1)
                PROSITE (2) -------SYNTAXIN  PDB: F:196-235                --------------------- PROSITE (2)
               Transcript 3 Exon 3.1  PDB: F:189-256 UniProt: 1-290 [INCOMPLETE]                 Transcript 3
                 3b5n F 189 ALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSA 256
                                   198       208       218       228       238       248

Chain G from PDB  Type:PROTEIN  Length:69
 aligned with SEC9_YEAST | P40357 from UniProtKB/Swiss-Prot  Length:651

    Alignment length:69
                                   440       450       460       470       480       490         
           SEC9_YEAST   431 QEIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKKL 499
               SCOP domains d3b5ng_ G: automated matches                                          SCOP domains
               CATH domains --------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---T_SNARE  PDB: G:434-496 UniProt: 434-496                       --- PROSITE
               Transcript 2 Exon 2.1  PDB: G:431-499 UniProt: 1-651 [INCOMPLETE]                  Transcript 2
                 3b5n G 431 GSIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKKL 499
                                   440       450       460       470       480       490

Chain H from PDB  Type:PROTEIN  Length:63
 aligned with SEC9_YEAST | P40357 from UniProtKB/Swiss-Prot  Length:651

    Alignment length:63
                                   597       607       617       627       637       647   
           SEC9_YEAST   588 DEMELEIDRNLDQIQQVSNRLKKMALTTGKELDSQQKRLNNIEESTDDLDINLHMNTNRLAGI 650
               SCOP domains --------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs)
                    PROSITE T_SNARE  PDB: H:589-650 UniProt: 588-650                        PROSITE
               Transcript 2 Exon 2.1  PDB: H:588-650 UniProt: 1-651 [INCOMPLETE]            Transcript 2
                 3b5n H 588 SEMELEIDRNLDQIQQVSNRLKKMALTTGKELDSQQKRLNNIEESTDDLDINLHMNTNRLAGI 650
                                   597       607       617       627       637       647

Chain I from PDB  Type:PROTEIN  Length:58
 aligned with SNC1_YEAST | P31109 from UniProtKB/Swiss-Prot  Length:117

    Alignment length:58
                                    38        48        58        68        78        
           SNC1_YEAST    29 TAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMW  86
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains 3b5nI00 I:29-86  [code=1.20.5.110, no name defined]        CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) V_SNARE  PDB: - UniProt: 28-88                             PROSITE (1)
                PROSITE (2) -----------------SYNAPTOBREVIN       --------------------- PROSITE (2)
               Transcript 1 1.1   Exon 1.2  PDB: I:35-86 UniProt: 35-117 [INCOMPLETE]  Transcript 1
                 3b5n I  29 TAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMW  86
                                    38        48        58        68        78

Chain J from PDB  Type:PROTEIN  Length:64
 aligned with SSO1_YEAST | P32867 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:64
                                   200       210       220       230       240       250    
           SSO1_YEAST   191 AEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVK 254
               SCOP domains d3b5nj1 J:191-254 Syntaxin 1A                                    SCOP domains
               CATH domains 3b5nJ00 J:191-254  [code=1.20.5.110, no name defined]            CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) T_SNARE  PDB: - UniProt: 190-252                              -- PROSITE (1)
                PROSITE (2) -----SYNTAXIN  PDB: J:196-235                ------------------- PROSITE (2)
               Transcript 3 Exon 3.1  PDB: J:191-254 UniProt: 1-290 [INCOMPLETE]             Transcript 3
                 3b5n J 191 AEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVK 254
                                   200       210       220       230       240       250

Chain K from PDB  Type:PROTEIN  Length:65
 aligned with SEC9_YEAST | P40357 from UniProtKB/Swiss-Prot  Length:651

    Alignment length:65
                                   443       453       463       473       483       493     
           SEC9_YEAST   434 KFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKK 498
               SCOP domains d3b5nk_ K: automated matches                                      SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE T_SNARE  PDB: K:434-496 UniProt: 434-496                       -- PROSITE
               Transcript 2 Exon 2.1  PDB: K:434-498 UniProt: 1-651 [INCOMPLETE]              Transcript 2
                 3b5n K 434 KFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKK 498
                                   443       453       463       473       483       493

Chain L from PDB  Type:PROTEIN  Length:62
 aligned with SEC9_YEAST | P40357 from UniProtKB/Swiss-Prot  Length:651

    Alignment length:62
                                   597       607       617       627       637       647  
           SEC9_YEAST   588 DEMELEIDRNLDQIQQVSNRLKKMALTTGKELDSQQKRLNNIEESTDDLDINLHMNTNRLAG 649
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE T_SNARE  PDB: L:589-649 UniProt: 588-650                       PROSITE
               Transcript 2 Exon 2.1  PDB: L:588-649 UniProt: 1-651 [INCOMPLETE]           Transcript 2
                 3b5n L 588 SEMELEIDRNLDQIQQVSNRLKKMALTTGKELDSQQKRLNNIEESTDDLDINLHMNTNRLAG 649
                                   597       607       617       627       637       647

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Single alpha-helices involved in coiled-coils or other helix-helix interfaces (552)

Homologous Superfamily: [code=1.20.5.110, no name defined] (17)

Baker's yeast (Saccharomyces cerevisiae) (1)

1a	3b5nJ00	J:191-254
1b	3b5nF00	F:189-256
1c	3b5nB00	B:189-257
1d	3b5nA00	A:26-86
1e	3b5nE00	E:29-86
1f	3b5nI00	I:29-86

(no "Pfam Domain" information available for 3B5N)

Asymmetric Unit(hide GO term definitions)

Chain A,E,I (SNC1_YEAST | P31109)

molecular function
	GO:0005484	SNAP receptor activity	Acting as a marker to identify a membrane and interacting selectively with one or more SNAREs on another membrane to mediate membrane fusion.
	GO:0000149	SNARE binding	Interacting selectively and non-covalently with a SNARE (soluble N-ethylmaleimide-sensitive factor attached protein receptor) protein.
biological process
	GO:0006893	Golgi to plasma membrane transport	The directed movement of substances from the Golgi to the plasma membrane in transport vesicles that move from the trans-Golgi network to the plasma membrane, where they fuse and release their contents by exocytosis.
	GO:0006897	endocytosis	A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
	GO:0006887	exocytosis	A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle. Exocytosis can occur either by full fusion, when the vesicle collapses into the plasma membrane, or by a kiss-and-run mechanism that involves the formation of a transient contact, a pore, between a granule (for exemple of chromaffin cells) and the plasma membrane. The latter process most of the time leads to only partial secretion of the granule content. Exocytosis begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when molecules are secreted from the cell.
	GO:0006906	vesicle fusion	Fusion of the membrane of a transport vesicle with its target membrane.
	GO:0016192	vesicle-mediated transport	A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
cellular component
	GO:0031201	SNARE complex	A protein complex involved in membrane fusion; a stable ternary complex consisting of a four-helix bundle, usually formed from one R-SNARE and three Q-SNAREs with an ionic layer sandwiched between hydrophobic layers. One well-characterized example is the neuronal SNARE complex formed of synaptobrevin 2, syntaxin 1a, and SNAP-25.
	GO:0005935	cellular bud neck	The constriction between the mother cell and daughter cell (bud) in an organism that reproduces by budding.
	GO:0012505	endomembrane system	A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005802	trans-Golgi network	The network of interconnected tubular and cisternal structures located within the Golgi apparatus on the side distal to the endoplasmic reticulum, from which secretory vesicles emerge. The trans-Golgi network is important in the later stages of protein secretion where it is thought to play a key role in the sorting and targeting of secreted proteins to the correct destination.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Chain B,F,J (SSO1_YEAST | P32867)

molecular function
	GO:0005484	SNAP receptor activity	Acting as a marker to identify a membrane and interacting selectively with one or more SNAREs on another membrane to mediate membrane fusion.
	GO:0000149	SNARE binding	Interacting selectively and non-covalently with a SNARE (soluble N-ethylmaleimide-sensitive factor attached protein receptor) protein.
	GO:0070300	phosphatidic acid binding	Interacting selectively and non-covalently with phosphatidic acid, any of a class of glycerol phosphate in which both the remaining hydroxyl groups of the glycerol moiety are esterified with fatty acids.
	GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	Interacting selectively and non-covalently with phosphatidylinositol-3,4-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' and 4' positions.
	GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	Interacting selectively and non-covalently with phosphatidylinositol-3,5-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' and 5' positions.
	GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	Interacting selectively and non-covalently with phosphatidylinositol-4,5-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 4' and 5' positions.
biological process
	GO:0030437	ascospore formation	The process in which cells that are products of meiosis acquire the specialized features of ascospores. Ascospores are generally found in clusters of four or eight spores within a single mother cell, the ascus, and are characteristic of the ascomycete fungi (phylum Ascomycota).
	GO:0031321	ascospore-type prospore assembly	During ascospore formation, the process in which each haploid nucleus becomes encapsulated by a double membrane.
	GO:0006886	intracellular protein transport	The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
	GO:0048278	vesicle docking	The initial attachment of a transport vesicle membrane to the target membrane, mediated by proteins protruding from the membrane of the vesicle and the target membrane. Docking requires only that the two membranes come close enough for these proteins to interact and adhere.
	GO:0006906	vesicle fusion	Fusion of the membrane of a transport vesicle with its target membrane.
	GO:0016192	vesicle-mediated transport	A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
cellular component
	GO:0031201	SNARE complex	A protein complex involved in membrane fusion; a stable ternary complex consisting of a four-helix bundle, usually formed from one R-SNARE and three Q-SNAREs with an ionic layer sandwiched between hydrophobic layers. One well-characterized example is the neuronal SNARE complex formed of synaptobrevin 2, syntaxin 1a, and SNAP-25.
	GO:0012505	endomembrane system	A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
	GO:0000329	fungal-type vacuole membrane	The lipid bilayer surrounding a vacuole, the shape of which correlates with cell cycle phase. The membrane separates its contents from the cytoplasm of the cell. An example of this structure is found in Saccharomyces cerevisiae.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005628	prospore membrane	The prospore membrane is a double-membraned structure that extends from the cytoplasmic face of the spindle pole bodies to encompass the spindle pole bodies and the four nuclear lobes that are formed during meiosis. It helps isolate the meiotic nuclei from the cytoplasm during spore formation and serves as a foundation for the formation of the spore walls. An example of this component is found in Schizosaccharomyces pombe.

Chain C,D,G,H,K,L (SEC9_YEAST | P40357)

molecular function
	GO:0005484	SNAP receptor activity	Acting as a marker to identify a membrane and interacting selectively with one or more SNAREs on another membrane to mediate membrane fusion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019905	syntaxin binding	Interacting selectively and non-covalently with a syntaxin, a SNAP receptor involved in the docking of synaptic vesicles at the presynaptic zone of a synapse.
biological process
	GO:0006887	exocytosis	A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle. Exocytosis can occur either by full fusion, when the vesicle collapses into the plasma membrane, or by a kiss-and-run mechanism that involves the formation of a transient contact, a pore, between a granule (for exemple of chromaffin cells) and the plasma membrane. The latter process most of the time leads to only partial secretion of the granule content. Exocytosis begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when molecules are secreted from the cell.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0006906	vesicle fusion	Fusion of the membrane of a transport vesicle with its target membrane.
cellular component
	GO:0031201	SNARE complex	A protein complex involved in membrane fusion; a stable ternary complex consisting of a four-helix bundle, usually formed from one R-SNARE and three Q-SNAREs with an ionic layer sandwiched between hydrophobic layers. One well-characterized example is the neuronal SNARE complex formed of synaptobrevin 2, syntaxin 1a, and SNAP-25.
	GO:0019897	extrinsic component of plasma membrane	The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3b5n)

	Sites
(no "Sites" information available for 3b5n)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3b5n)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3b5n
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SEC9_YEAST \| P40357
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SNC1_YEAST \| P31109
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SSO1_YEAST \| P32867
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SEC9_YEAST \| P40357
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SNC1_YEAST \| P31109
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SSO1_YEAST \| P32867
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SSO1_YEAST \| P32867	:	1fio

(no "Related Entries Specified in the PDB File" available for 3B5N)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (4, 15)

Exons (4, 15)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 8)

CATH Domains (1, 6)

Pfam Domains (0, 0)

Gene Ontology (31, 44)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File