Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HIGH RESOLUTION STRUCTURE OF PENICILLIUM CHRYSOGENUM ALPHA-L-ARABINANASE COMPLEXED WITH ARABINOBIOSE
 
Authors :  Y. Sogabe
Date :  11 Sep 09  (Deposition) - 15 Sep 10  (Release) - 25 May 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.04
Chains :  Asym./Biol. Unit :  A
Keywords :  Arabinase, Glycosyl Hydrolase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Sogabe, T. Kitatani, A. Yamaguchi, T. Kinoshita, H. Adachi, K. Takano, T. Inoue, Y. Mori, H. Matsumura, T. Sakamoto, T. Tada
High-Resolution Structure Of Exo-Arabinanase From Penicillium Chrysogenum
Acta Crystallogr. , Sect. D V. 67 415 2011
PubMed-ID: 21543843  |  Reference-DOI: 10.1107/S0907444911006299

(-) Compounds

Molecule 1 - EXO-ARABINANASE
    ChainsA
    EC Number3.2.1.55
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET3A
    Expression System StrainBL21(DE3)PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 24-378
    Organism CommonPENICILLIUM NOTATUM
    Organism ScientificPENICILLIUM CHRYSOGENUM
    Organism Taxid5076
    Strain31B
    SynonymEXO-1,5-ALPHA-L-ARABINANASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1AHR2Ligand/IonALPHA-L-ARABINOFURANOSE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPRO A:165 , TRP A:173 , GLU A:174 , GLN A:199 , ARG A:227 , GLY A:229 , MET A:230 , GLU A:246 , TYR A:337 , AHR A:402 , HOH A:1036 , HOH A:1198 , HOH A:1211BINDING SITE FOR RESIDUE AHR A 401
2AC2SOFTWAREGLU A:64 , GLN A:105 , PRO A:165 , LEU A:360 , AHR A:401 , HOH A:1019 , HOH A:1021 , HOH A:1024 , HOH A:1210 , HOH A:1400BINDING SITE FOR RESIDUE AHR A 402

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3A72)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Val A:43 -Pro A:44
2Glu A:69 -Pro A:70
3Pro A:70 -Pro A:71

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3A72)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3A72)

(-) Exons   (0, 0)

(no "Exon" information available for 3A72)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:353
 aligned with Q7ZA77_PENCH | Q7ZA77 from UniProtKB/TrEMBL  Length:378

    Alignment length:353
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375   
         Q7ZA77_PENCH    26 PTSLTNVTIFSPPSDYIVPRTLYPRNEQLPNGDLLATWENYSPEPPAVYFPIYRSKDHGKTWNEISRVHDTVNGYGLRYQPFLYSLPERVGSFKKGTLLLAGSSIPTDLSSTDIVLYASQDDGMTWDFVSHIAAGGEARPNNGLTPVWEPFLLANKGKLICYYSDQRDNATYGQTMVHQVTNDLKNWGPVVEDVTYPTYTDRPGMPVVTKLPNGQYFYVYEYGSFFGTETYSFPLYYRLSSDPENIASAPGQRLVVSSGTQPTSSPYAVWTPYGGENGTIIVSSGTQGTLFINKALGEGEWTEIPCPEEHGYTRALRVLSEDGGRYLVVNSAGVLLGENNRVSVSVMDLKEVL 378
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee..........eeeeeeee.....eeeeeee.........eeeeee.......eeeeee........eeeeeeeee............eeeeeee.......eeeeeeee.......eeeeeeeee...........eeeeeeeee..eeeeeeee.........eeeeeee.........eeee.......eeeeeeeee.....eeeeeeee...........eeeeee...........ee.............eeeee.......eeeee......eeee........eee..........eeee.hhhhhheeeeee..........eeeeeeehhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3a72 A  26 PTSLTNVTIFSPPSDYIVPRTLYPRNEQLPNGDLLATWENYSPEPPAVYFPIYRSKDHGKTWNEISRVHDTVNGYGLRYQPFLYSLPERVGSFKKGTLLLAGSSIPTDLSSTDIVLYASQDDGMTWDFVSHIAAGGEARPNNGLTPVWEPFLLANKGKLICYYSDQRDNATYGQTMVHQVTNDLKNWGPVVEDVTYPTYTDRPGMPVVTKLPNGQYFYVYEYGSFFGTETYSFPLYYRLSSDPENIASAPGQRLVVSSGTQPTSSPYAVWTPYGGENGTIIVSSGTQGTLFINKALGEGEWTEIPCPEEHGYTRALRVLSEDGGRYLVVNSAGVLLGENNRVSVSVMDLKEVL 378
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3A72)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3A72)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3A72)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3A72)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    AHR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:69 - Pro A:70   [ RasMol ]  
    Pro A:70 - Pro A:71   [ RasMol ]  
    Val A:43 - Pro A:44   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3a72
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7ZA77_PENCH | Q7ZA77
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.55
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q7ZA77_PENCH | Q7ZA77
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q7ZA77_PENCH | Q7ZA773a71

(-) Related Entries Specified in the PDB File

3a71