Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CYTOCHROME B6F COMPLEX FROM NOSTOC SP. PCC 7120
 
Authors :  W. A. Craner, Baniulis D. , Yamashita E.
Date :  27 Sep 08  (Deposition) - 10 Feb 09  (Release) - 11 Dec 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B,C,D,E,F,G,H  (2x)
Keywords :  Photosynthesis, Cytochrome B6F Complex, Heme B, 2Fe-2S Protein, Cytochrome F (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Baniulis, E. Yamashita, J. P. Whitelegge, A. I. Zatsman, M. P. Hendrich, S. S. Hasan, C. M. Ryan, W. A. Cramer
Structure-Function, Stability, And Chemical Modification Of The Cyanobacterial Cytochrome B6F Complex From Nostoc Sp. Pcc 7120
J. Biol. Chem. V. 284 9861 2009
PubMed-ID: 19189962  |  Reference-DOI: 10.1074/JBC.M809196200

(-) Compounds

Molecule 1 - CYTOCHROME B6
    ChainsA
    Organism ScientificNOSTOC SP. PCC 7120
    Organism Taxid103690
 
Molecule 2 - CYTOCHROME B6-F COMPLEX SUBUNIT 4
    ChainsB
    Organism ScientificNOSTOC SP. PCC 7120
    Organism Taxid103690
    Synonym17 KDA POLYPEPTIDE
 
Molecule 3 - APOCYTOCHROME F
    ChainsC
    Organism ScientificNOSTOC SP. PCC 7120
    Organism Taxid103690
    SynonymCYTOCHROME F
 
Molecule 4 - CYTOCHROME B6-F COMPLEX IRON-SULFUR SUBUNIT 1
    ChainsD
    EC Number1.10.99.1
    Organism ScientificNOSTOC SP. PCC 7120
    Organism Taxid103690
    PlastohydroquinonePLASTOCYANIN OXIDOREDUCTASE IRON-SULFUR PROTEIN 1, ISP 1, RISP 1
    SynonymRIESKE IRON-SULFUR PROTEIN 1,
 
Molecule 5 - CYTOCHROME B6-F COMPLEX SUBUNIT 6
    ChainsE
    Organism ScientificNOSTOC SP. PCC 7120
    Organism Taxid103690
    SynonymCYTOCHROME B6-F COMPLEX SUBUNIT VI, CYTOCHROME B6-F COMPLEX SUBUNIT PETL
 
Molecule 6 - CYTOCHROME B6-F COMPLEX SUBUNIT 7
    ChainsF
    Organism ScientificNOSTOC SP. PCC 7120
    Organism Taxid103690
    SynonymCYTOCHROME B6-F COMPLEX SUBUNIT VII, CYTOCHROME B6-F COMPLEX SUBUNIT PETM
 
Molecule 7 - CYTOCHROME B6-F COMPLEX SUBUNIT 5
    ChainsG
    Organism ScientificNOSTOC SP. PCC 7120
    Organism Taxid103690
    SynonymCYTOCHROME B6-F COMPLEX SUBUNIT V, CYTOCHROME B6-F COMPLEX SUBUNIT PETG
 
Molecule 8 - CYTOCHROME B6-F COMPLEX SUBUNIT 8
    ChainsH
    Organism ScientificNOSTOC SP. PCC 7120
    Organism Taxid103690
    SynonymCYTOCHROME B6-F COMPLEX SUBUNIT VIII, CYTOCHROME B6-F COMPLEX SUBUNIT PETN

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABCDEFGH
Biological Unit 1 (2x)ABCDEFGH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (7, 13)

Asymmetric Unit (7, 13)
No.NameCountTypeFull Name
1BCR1Ligand/IonBETA-CAROTENE
2CLA1Ligand/IonCHLOROPHYLL A
3FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER
4HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
5OPC2Ligand/Ion(7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE
6SQD1Ligand/Ion1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
7UMQ3Ligand/IonUNDECYL-MALTOSIDE
Biological Unit 1 (7, 26)
No.NameCountTypeFull Name
1BCR2Ligand/IonBETA-CAROTENE
2CLA2Ligand/IonCHLOROPHYLL A
3FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
4HEM8Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
5OPC4Ligand/Ion(7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE
6SQD2Ligand/Ion1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
7UMQ6Ligand/IonUNDECYL-MALTOSIDE

(-) Sites  (13, 13)

Asymmetric Unit (13, 13)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLN A:47 , PHE A:48 , GLY A:51 , MET A:54 , ARG A:83 , HIS A:86 , ARG A:87 , ALA A:90 , MET A:93 , PHE A:131 , GLY A:135 , PRO A:139 , HIS A:187 , PHE A:189BINDING SITE FOR RESIDUE HEM A 301
02AC2SOFTWARETYR A:34 , GLY A:37 , GLY A:38 , THR A:40 , LEU A:41 , MET A:93 , HIS A:100 , VAL A:101 , ARG A:103 , VAL A:104 , GLY A:109 , TRP A:118 , GLY A:121 , VAL A:122 , HIS A:202 , PHE A:203 , ILE A:206 , ILE A:211 , SER A:212 , HEM A:303 , HOH A:401BINDING SITE FOR RESIDUE HEM A 302
03AC3SOFTWARETYR A:34 , CYS A:35 , GLY A:38 , LEU A:41 , ILE A:206 , ARG A:207 , GLY A:210 , ILE A:211 , HEM A:302 , HOH A:401 , VAL B:39 , PHE B:40 , ARG H:26BINDING SITE FOR RESIDUE HEM A 303
04AC4SOFTWARETYR C:1 , PRO C:2 , TRP C:4 , CYS C:22 , CYS C:25 , HIS C:26 , GLN C:60 , LEU C:70 , ASN C:71 , VAL C:72 , GLY C:73 , ASN C:154 , GLY C:156 , ARG C:157 , GLY C:158 , VAL C:160 , TYR C:161 , PRO C:162BINDING SITE FOR RESIDUE HEM C 301
05AC5SOFTWARECYS D:108 , HIS D:110 , LEU D:111 , CYS D:126 , HIS D:129 , SER D:131BINDING SITE FOR RESIDUE FES D 200
06AC6SOFTWAREILE A:98 , PHE A:102 , TYR A:105 , TYR B:80 , VAL B:84 , ILE B:87 , MET B:101 , PHE B:133 , GLY B:136 , THR B:140 , OPC B:202 , HOH B:211BINDING SITE FOR RESIDUE CLA B 201
07AC7SOFTWAREILE A:32 , PHE A:33 , ILE A:39 , LEU A:99 , ILE F:16 , TRP F:20 , VAL G:16 , ALA G:19 , GLY G:20 , TYR G:23 , PHE H:15 , ILE H:19 , OPC H:30BINDING SITE FOR RESIDUE BCR G 101
08AC8SOFTWARESER B:103 , VAL B:111 , ILE B:114 , GLU B:115 , ASN B:118 , ARG B:126 , VAL B:128 , ALA B:129 , CLA B:201BINDING SITE FOR RESIDUE OPC B 202
09AC9SOFTWAREMET A:92 , PRO C:37 , GLN C:38 , TYR E:7 , ILE E:8 , SER F:12 , LEU G:5 , BCR G:101 , MET H:1 , TRP H:8 , LEU H:12BINDING SITE FOR RESIDUE OPC H 30
10BC1SOFTWAREGLU A:75 , VAL A:76 , ASN A:77 , PHE A:78 , TRP A:80 , ASN C:253 , ARG C:254 , TRP C:257BINDING SITE FOR RESIDUE UMQ A 304
11BC2SOFTWAREASN A:3 , TYR A:5 , UMQ A:306 , SQD B:203BINDING SITE FOR RESIDUE UMQ A 305
12BC3SOFTWAREGLN A:15 , ALA A:18 , GLU A:19 , THR A:22 , UMQ A:305 , TRP B:32 , SQD B:203 , ASN C:288BINDING SITE FOR RESIDUE UMQ A 306
13BC4SOFTWAREUMQ A:305 , UMQ A:306 , TRP B:32 , PRO B:33 , LYS C:275 , ARG D:16 , ASN D:20 , THR D:28BINDING SITE FOR RESIDUE SQD B 203

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1D:108 -D:126
2D:113 -D:128

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ZT9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2ZT9)

(-) PROSITE Motifs  (3, 3)

Asymmetric Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTB_NTERPS51002 Cytochrome b/b6 N-terminal region profile.CYB6_NOSS14-215  1A:4-215
2CYTB_CTERPS51003 Cytochrome b/b6 C-terminal region profile.PETD_NOSS135-160  1B:35-160
3RIESKEPS51296 Rieske [2Fe-2S] iron-sulfur domain profile.UCRIA_NOSS161-162  1D:61-162
Biological Unit 1 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTB_NTERPS51002 Cytochrome b/b6 N-terminal region profile.CYB6_NOSS14-215  2A:4-215
2CYTB_CTERPS51003 Cytochrome b/b6 C-terminal region profile.PETD_NOSS135-160  2B:35-160
3RIESKEPS51296 Rieske [2Fe-2S] iron-sulfur domain profile.UCRIA_NOSS161-162  2D:61-162

(-) Exons   (0, 0)

(no "Exon" information available for 2ZT9)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:215
 aligned with CYB6_NOSS1 | P0A384 from UniProtKB/Swiss-Prot  Length:215

    Alignment length:215
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210     
           CYB6_NOSS1     1 MANVYDWFEERLEIQAIAEDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFYYKPTVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVSGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL 215
               SCOP domains d2zt9a_ A: automated matches                                                                                                                                                                                            SCOP domains
               CATH domains 2zt9A00 A:1-215 Cytochrome Bc1 Complex; Chain C                                                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------Cytochrom_B_N_2-2zt9A01 A:91-215                                                                                              Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhh..ee....hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---CYTB_NTER  PDB: A:4-215 UniProt: 4-215                                                                                                                                                                               PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zt9 A   1 MANVYDWFEERLEIQAIAEDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFYYKPTVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVSGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL 215
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210     

Chain B from PDB  Type:PROTEIN  Length:160
 aligned with PETD_NOSS1 | Q93SX1 from UniProtKB/Swiss-Prot  Length:160

    Alignment length:160
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160
           PETD_NOSS1     1 MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF 160
               SCOP domains d2zt9b_ B: automated matches                                                                                                                                     SCOP domains
               CATH domains --------2zt9B01 B:9-66 Cytochrome C Oxidase, chain M              2zt9B02 B:67-160 plastocyanin oxidoreductase                                                   CATH domains
               Pfam domains ----------------------------------------------------------------Cytochrom_B_C-2zt9B01 B:65-158                                                                -- Pfam domains
         Sec.struct. author ..........hhhhhhhhhh........eehhhhhhhhhhhhhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------CYTB_CTER  PDB: B:35-160 UniProt: 35-160                                                                                       PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zt9 B   1 MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF 160
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160

Chain C from PDB  Type:PROTEIN  Length:289
 aligned with CYF_NOSS1 | Q93SW9 from UniProtKB/Swiss-Prot  Length:333

    Alignment length:289
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324         
            CYF_NOSS1    45 YPFWAQQTYPETPREPTGRIVCANCHLAAKPTEVEVPQSVLPDTVFKAVVKIPYDTSVQQVGADGSKVGLNVGAVLMLPEGFKIAPEDRIPEELKEEIGDVYFQPYGEDKDNIVIVGPLPGEQYQEIVFPVLSPNPANDKNIHFGKYSVHVGGNRGRGQVYPTGEKSNNNLYSAAATGTISKIAKQEGEDGSVKYLVDIKTESGEVVSDTIPAGPELIVSEGQAVTAGDALTNNPNVGGFGQLDAEIVLQDANRVGWLIAFVALVMLAQVMLVLKKKQVEKVQAAEMNF 333
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2zt9C01 C:1-171,C:234-254  [code=2.60.40.830, no name defined]                                                                                                             2zt9C02 C:172-233  [code=2.40.50.100, no name defined]        2zt9C01              2zt9C03 C:255-289 Single helix bin  CATH domains
               Pfam domains -----------------------------------------------------------------------------------------------------------------------------------------------------------------------Apocytochr_F_C-2zt9C01 C:168-289                                                                                           Pfam domains
         Sec.struct. author hhhhhhhhh..........hhhhhh.......eee...ee....eeeeeee........ee.....ee..eeeeeee.....ee.hhhhhhhhhhhhhh...eee.......eeeeeeee.....eeeeeee..hhhhh.....eeeeeeeeeee......................ee..............ee...............ee...........ee.............eeeeeeeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zt9 C   1 YPFWAQQTYPETPREPTGRIVCANCHLAAKPTEVEVPQSVLPDTVFKAVVKIPYDTSVQQVGADGSKVGLNVGAVLMLPEGFKIAPEDRIPEELKEEIGDVYFQPYGEDKDNIVIVGPLPGEQYQEIVFPVLSPNPANDKNIHFGKYSVHVGGNRGRGQVYPTGEKSNNNLYSAAATGTISKIAKQEGEDGSVKYLVDIKTESGEVVSDTIPAGPELIVSEGQAVTAGDALTNNPNVGGFGQLDAEIVLQDANRVGWLIAFVALVMLAQVMLVLKKKQVEKVQAAEMNF 289
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280         

Chain D from PDB  Type:PROTEIN  Length:166
 aligned with UCRIA_NOSS1 | Q93SX0 from UniProtKB/Swiss-Prot  Length:179

    Alignment length:171
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178 
          UCRIA_NOSS1     9 DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVVESKEAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS 179
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------2zt9D02 D:48-179 'Rieske'-like iron-sulphur d     omains                                                                             CATH domains
               Pfam domains CytB6-F_Fe-S-2zt9D02 D:9-46           --------------------Rieske-2zt9D01 D:67-158                                                                     --------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....................hhhhhhhh......eeee.hhh.eeee.-----....eeee...........ee....eee......ee................eeeeeee..eeeeee............... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------RIESKE  PDB: D:61-162 UniProt: 61-162                                                                 ----------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zt9 D   9 DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIV-----AITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS 179
                                    18        28        38        48        58        68        78        88   |    98       108       118       128       138       148       158       168       178 
                                                                                                              92    98                                                                                 

Chain E from PDB  Type:PROTEIN  Length:31
 aligned with PETL_NOSS1 | Q8YVQ2 from UniProtKB/Swiss-Prot  Length:31

    Alignment length:31
                                    10        20        30 
           PETL_NOSS1     1 MLAIVAYIGFLALFTGIAAGLLFGLRSAKIL  31
               SCOP domains ------------------------------- SCOP domains
               CATH domains ------------------------------- CATH domains
               Pfam domains PetL-2zt9E01 E:1-31             Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------- PROSITE
                 Transcript ------------------------------- Transcript
                 2zt9 E   1 MLAIVAYIGFLALFTGIAAGLLFGLRSAKIL  31
                                    10        20        30 

Chain F from PDB  Type:PROTEIN  Length:32
 aligned with PETM_NOSS1 | P0A3Y1 from UniProtKB/Swiss-Prot  Length:34

    Alignment length:32
                                    10        20        30  
           PETM_NOSS1     1 MSGELLNAALLSFGLIFVGWALGALLLKIQGA  32
               SCOP domains d2zt9f_ F: automated matches     SCOP domains
               CATH domains -------------------------------- CATH domains
               Pfam domains --PetM-2zt9F01 F:3-32            Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------- PROSITE
                 Transcript -------------------------------- Transcript
                 2zt9 F   1 MSGELLNAALLSFGLIFVGWALGALLLKIQGA  32
                                    10        20        30  

Chain G from PDB  Type:PROTEIN  Length:37
 aligned with PETG_NOSS1 | P58246 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:37
                                    10        20        30       
           PETG_NOSS1     1 MVEPLLSGIVLGLIVVTLAGLFYAAYKQYKRPNELGG  37
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains PetG-2zt9G01 G:1-37                   Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                 2zt9 G   1 MVEPLLSGIVLGLIVVTLAGLFYAAYKQYKRPNELGG  37
                                    10        20        30       

Chain H from PDB  Type:PROTEIN  Length:29
 aligned with PETN_NOSS1 | P61048 from UniProtKB/Swiss-Prot  Length:29

    Alignment length:29
                                    10        20         
           PETN_NOSS1     1 MAILTLGWVSLLVVFTWSIAMVVWGRNGL  29
               SCOP domains d2zt9h_ H: automated matches  SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains PetN-2zt9H01 H:1-29           Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 2zt9 H   1 MAILTLGWVSLLVVFTWSIAMVVWGRNGL  29
                                    10        20         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (4, 4)

Asymmetric Unit

(-) CATH Domains  (7, 7)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (9, 9)

Asymmetric Unit
(-)
Clan: Hybrid (58)

(-) Gene Ontology  (23, 85)

Asymmetric Unit(hide GO term definitions)
Chain A   (CYB6_NOSS1 | P0A384)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0045158    electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity    Enables the directed movement of electrons within the cytochrome b6/f complex of photosystem II.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0022900    electron transport chain    A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0022904    respiratory electron transport chain    A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain B   (PETD_NOSS1 | Q93SX1)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0045158    electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity    Enables the directed movement of electrons within the cytochrome b6/f complex of photosystem II.
    GO:0045156    electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity    Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0009767    photosynthetic electron transport chain    A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain C   (CYF_NOSS1 | Q93SW9)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0031361    integral component of thylakoid membrane    The component of the thylakoid membrane consisting of the gene products having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain D   (UCRIA_NOSS1 | Q93SX0)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0045158    electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity    Enables the directed movement of electrons within the cytochrome b6/f complex of photosystem II.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016679    oxidoreductase activity, acting on diphenols and related substances as donors    Catalysis of an oxidation-reduction (redox) reaction in which a diphenol or related substance acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
    GO:0009496    plastoquinol--plastocyanin reductase activity    Catalysis of the reaction: 2 H(+)[side 1] + 2 oxidized plastocyanin + plastoquinol-1 = 2 H(+)[side 2] + 2 reduced plastocyanin + plastoquinone. This reaction involves the concomitant transfer of 2 H+ ions across a membrane.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain E   (PETL_NOSS1 | Q8YVQ2)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0045158    electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity    Enables the directed movement of electrons within the cytochrome b6/f complex of photosystem II.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0009512    cytochrome b6f complex    Complex that transfers electrons from reduced plastoquinone to oxidized plastocyanin and translocates protons from the stroma to the lumen. The complex contains a core structure of three catalytic subunits: cytochrome b, the Rieske iron sulfur protein (ISP), and cytochrome f, which are arranged in an integral membrane-bound dimeric complex; additional subunits are present, and vary among different species.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain F   (PETM_NOSS1 | P0A3Y1)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0009512    cytochrome b6f complex    Complex that transfers electrons from reduced plastoquinone to oxidized plastocyanin and translocates protons from the stroma to the lumen. The complex contains a core structure of three catalytic subunits: cytochrome b, the Rieske iron sulfur protein (ISP), and cytochrome f, which are arranged in an integral membrane-bound dimeric complex; additional subunits are present, and vary among different species.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain G   (PETG_NOSS1 | P58246)
molecular function
    GO:0045158    electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity    Enables the directed movement of electrons within the cytochrome b6/f complex of photosystem II.
biological process
    GO:0017004    cytochrome complex assembly    The aggregation, arrangement and bonding together of a cytochrome complex. A cytochrome complex is a protein complex in which at least one of the proteins is a cytochrome, i.e. a heme-containing protein involved in catalysis of redox reactions.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0009512    cytochrome b6f complex    Complex that transfers electrons from reduced plastoquinone to oxidized plastocyanin and translocates protons from the stroma to the lumen. The complex contains a core structure of three catalytic subunits: cytochrome b, the Rieske iron sulfur protein (ISP), and cytochrome f, which are arranged in an integral membrane-bound dimeric complex; additional subunits are present, and vary among different species.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain H   (PETN_NOSS1 | P61048)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0045158    electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity    Enables the directed movement of electrons within the cytochrome b6/f complex of photosystem II.
biological process
    GO:0017004    cytochrome complex assembly    The aggregation, arrangement and bonding together of a cytochrome complex. A cytochrome complex is a protein complex in which at least one of the proteins is a cytochrome, i.e. a heme-containing protein involved in catalysis of redox reactions.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0009512    cytochrome b6f complex    Complex that transfers electrons from reduced plastoquinone to oxidized plastocyanin and translocates protons from the stroma to the lumen. The complex contains a core structure of three catalytic subunits: cytochrome b, the Rieske iron sulfur protein (ISP), and cytochrome f, which are arranged in an integral membrane-bound dimeric complex; additional subunits are present, and vary among different species.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BCR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OPC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SQD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UMQ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2zt9)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2zt9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYB6_NOSS1 | P0A384
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CYF_NOSS1 | Q93SW9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PETD_NOSS1 | Q93SX1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PETG_NOSS1 | P58246
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PETL_NOSS1 | Q8YVQ2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PETM_NOSS1 | P0A3Y1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PETN_NOSS1 | P61048
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UCRIA_NOSS1 | Q93SX0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.10.99.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CYB6_NOSS1 | P0A384
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CYF_NOSS1 | Q93SW9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PETD_NOSS1 | Q93SX1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PETG_NOSS1 | P58246
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PETL_NOSS1 | Q8YVQ2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PETM_NOSS1 | P0A3Y1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PETN_NOSS1 | P61048
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  UCRIA_NOSS1 | Q93SX0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYB6_NOSS1 | P0A3844h44 4ogq
        CYF_NOSS1 | Q93SW91tu2 4h44 4ogq
        PETD_NOSS1 | Q93SX14h44 4ogq
        PETG_NOSS1 | P582464h44 4ogq
        PETL_NOSS1 | Q8YVQ24h44 4ogq
        PETM_NOSS1 | P0A3Y14h44 4ogq
        PETN_NOSS1 | P610484h44 4ogq
        UCRIA_NOSS1 | Q93SX04h44 4ogq

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ZT9)