2ZQY - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   T-STATE STRUCTURE OF ALLOSTERIC L-LACTATE DEHYDROGENASE FROM LACTOBACILLUS CASEI

Authors :   K. Arai, T. Ishimitsu, S. Fushinobu, H. Uchikoba, H. Matsuzawa, H. Taguchi

Date :   22 Aug 08 (Deposition) - 08 Sep 09 (Release) - 09 Feb 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Oxidoreductase, Rossmann Fold, Cytoplasm, Glycolysis, Nad, Phosphoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Arai, T. Ishimitsu, S. Fushinobu, H. Uchikoba, H. Matsuzawa, H. Taguchi
Active And Inactive State Structures Of Unliganded Lactobacillus Casei Allosteric L-Lactate Dehydrogenase.
Proteins V. 78 681 2010
PubMed-ID: 19787773 | Reference-DOI: 10.1002/PROT.22597

Molecule 1 - L-LACTATE DEHYDROGENASE
	Chains	:	A, B, C, D
	EC Number	:	1.1.1.27
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PLCEX
	Expression System Strain	:	MV1184
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	LDH
	Organism Scientific	:	LACTOBACILLUS CASEI
	Organism Taxid	:	1582
	Strain	:	IAM 12473
	Synonym	:	L-LDH

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 8)

No.	Name	Count	Type	Full Name
1	NO3	8	Ligand/Ion	NITRATE ION

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:186 , ALA A:187 , TYR A:188 , HIS A:203 , ASN A:205	BINDING SITE FOR RESIDUE NO3 A 1
2	AC2	SOFTWARE	SER A:184 , HIS A:186 , GLY A:207 , ARG D:171 , HIS D:186 , TYR D:188 , HOH D:367	BINDING SITE FOR RESIDUE NO3 A 7
3	AC3	SOFTWARE	ARG A:171 , HIS A:186 , TYR A:188 , SER D:184 , HIS D:186 , GLY D:207	BINDING SITE FOR RESIDUE NO3 A 8
4	AC4	SOFTWARE	HIS B:186 , ALA B:187 , TYR B:188 , HIS B:203 , HOH B:395 , HOH B:402 , GLY C:208	BINDING SITE FOR RESIDUE NO3 B 2
5	AC5	SOFTWARE	ARG B:171 , TYR B:188 , HOH B:356 , HOH B:402 , SER C:184 , HIS C:186 , GLY C:207	BINDING SITE FOR RESIDUE NO3 B 5
6	AC6	SOFTWARE	SER B:184 , HIS B:186 , GLY B:207 , HOH B:404 , ARG C:171 , TYR C:188 , HOH C:379	BINDING SITE FOR RESIDUE NO3 B 6
7	AC7	SOFTWARE	GLY B:208 , HIS C:186 , ALA C:187 , TYR C:188 , HIS C:203 , ALA C:204 , HOH C:408	BINDING SITE FOR RESIDUE NO3 C 3
8	AC8	SOFTWARE	GLY A:208 , HIS D:186 , ALA D:187 , TYR D:188 , HIS D:203 , ALA D:204 , HOH D:367 , HOH D:408	BINDING SITE FOR RESIDUE NO3 D 4

(no "SS Bond" information available for 2ZQY)

Asymmetric/Biological Unit

No.	Residues
1	Asn A:138	-	Pro A:139
2	Asn B:138	-	Pro B:139
3	Asn C:138	-	Pro C:139
4	Asn D:138	-	Pro D:139

(no "SAP(SNP)/Variant" information available for 2ZQY)

Asymmetric/Biological Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	L_LDH	PS00064	L-lactate dehydrogenase active site.	LDH_LACCA	178-184	4	A:190-196 B:190-196 C:190-196 D:190-196

(no "Exon" information available for 2ZQY)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:305
 aligned with LDH_LACCA | P00343 from UniProtKB/Swiss-Prot  Length:326

    Alignment length:308
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309        
            LDH_LACCA    10 QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF 317
               SCOP domains d2zqya1 A:21-162 Lactate dehydrogenase                                                                                                       d2zqya2 A:163-329 Lactate dehydrogenase                                                                                                                                 SCOP domains
               CATH domains 2zqyA01 A:21-162 NAD(P)-binding Rossmann-like Domain                                                                                         2zqyA02 A:163-329 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhhhhh...eeee.hhhhhhhh.eeee.....---...hhhhhhhhhhhhhhhhhhhhhh....eeee...hhhhhhhhhhhhhh.....eee..hhhhhhhhhhhhhhhhh.hhh.ee..ee.......ee.....ee..eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------L_LDH  ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zqy A  21 QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAP---GETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF 329
                                    30        40        50        60        70  ||    81        91       | - |     111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321        
                                                                               73|                      99 103                                                                                                                                                                                                                                  
                                                                                75

Chain B from PDB  Type:PROTEIN  Length:308
 aligned with LDH_LACCA | P00343 from UniProtKB/Swiss-Prot  Length:326

    Alignment length:308
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309        
            LDH_LACCA    10 QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF 317
               SCOP domains d2zqyb1 B:21-162 Lactate dehydrogenase                                                                                                       d2zqyb2 B:163-329 Lactate dehydrogenase                                                                                                                                 SCOP domains
               CATH domains 2zqyB01 B:21-162 NAD(P)-binding Rossmann-like Domain                                                                                         2zqyB02 B:163-329 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhhhhhh...eeee.hhhhhhhh.eeee..........hhhhhhhhhhhhhhhhhhhhhh.....eeee...hhhhhhhhhhhhhh.hhh.eee..hhhhhhhhhhhhhhhhh.hhh.ee..ee.......ee.....ee..eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------L_LDH  ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zqy B  21 QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF 329
                                    30        40        50        60        70  ||    81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321        
                                                                               73|                                                                                                                                                                                                                                                              
                                                                                75

Chain C from PDB  Type:PROTEIN  Length:316
 aligned with LDH_LACCA | P00343 from UniProtKB/Swiss-Prot  Length:326

    Alignment length:316
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319      
            LDH_LACCA    10 QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFAKNDIETR 325
               SCOP domains d2zqyc1 C:21-162 Lactate dehydrogenase                                                                                                       d2zqyc2 C:163-337 Lactate dehydrogenase                                                                                                                                         SCOP domains
               CATH domains 2zqyC01 C:21-162 NAD(P)-binding Rossmann-like Domain                                                                                         2zqyC02 C:163-332 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                               ----- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhhhhh...eeee.hhhhhhhh.eeee..........hhhhhhhhhhhhhhhhhhhhhhh....eeee...hhhhhhhhhhhhhh.hhh.eee..hhhhhhhhhhhhhhhhh.hhh.ee..ee.......ee.....ee..eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------L_LDH  --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zqy C  21 QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFAKNDIETR 337
                                    30        40        50        60        70  ||    81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331      
                                                                               73|                                                                                                                                                                                                                                                                      
                                                                                75

Chain D from PDB  Type:PROTEIN  Length:305
 aligned with LDH_LACCA | P00343 from UniProtKB/Swiss-Prot  Length:326

    Alignment length:308
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309        
            LDH_LACCA    10 QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF 317
               SCOP domains d2zqyd1 D:21-162 Lactate dehydrogenase                                                                                                       d2zqyd2 D:163-329 Lactate dehydrogenase                                                                                                                                 SCOP domains
               CATH domains 2zqyD01 D:21-162 NAD(P)-binding Rossmann-like Domain                                                                                         2zqyD02 D:163-329 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                             CATH domains
           Pfam domains (1) Ldh_1_N-2zqyD05 D:21-161                                                                                                                    -Ldh_1_C-2zqyD01 D:163-329                                                                                                                                               Pfam domains (1)
           Pfam domains (2) Ldh_1_N-2zqyD06 D:21-161                                                                                                                    -Ldh_1_C-2zqyD02 D:163-329                                                                                                                                               Pfam domains (2)
           Pfam domains (3) Ldh_1_N-2zqyD07 D:21-161                                                                                                                    -Ldh_1_C-2zqyD03 D:163-329                                                                                                                                               Pfam domains (3)
           Pfam domains (4) Ldh_1_N-2zqyD08 D:21-161                                                                                                                    -Ldh_1_C-2zqyD04 D:163-329                                                                                                                                               Pfam domains (4)
         Sec.struct. author .eeeee..hhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhhhhhh...eeee.hhhhhh...eeee.....---..hhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee..hhhhhhhhhhhhhhhhh.hhh.ee..ee.......ee.....ee..eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------L_LDH  ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zqy D  21 QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAP---GETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF 329
                                    30        40        50        60        70  ||    81        91       | - |     111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321        
                                                                               73|                      99 103                                                                                                                                                                                                                                  
                                                                                75

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: LDH C-terminal domain-like (172)

Superfamily: LDH C-terminal domain-like (172)

Family: Lactate & malate dehydrogenases, C-terminal domain (125)

Protein domain: Lactate dehydrogenase (55)

Lactobacillus casei [TaxId: 1582] (6)

1a	d2zqya2	A:163-329
1b	d2zqyb2	B:163-329
1c	d2zqyc2	C:163-337
1d	d2zqyd2	D:163-329

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: LDH N-terminal domain-like (117)

Protein domain: Lactate dehydrogenase (53)

Lactobacillus casei [TaxId: 1582] (6)

2a	d2zqya1	A:21-162
2b	d2zqyb1	B:21-162
2c	d2zqyc1	C:21-162
2d	d2zqyd1	D:21-162

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Lactobacillus casei. Organism_taxid: 1582. Strain: iam 12473. (2)

1a	2zqyB01	B:21-162
1b	2zqyC01	C:21-162
1c	2zqyA01	A:21-162
1d	2zqyD01	D:21-162

Architecture: Alpha-Beta Complex (3881)

Topology: L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 (116)

Homologous Superfamily: L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2 (116)

Lactobacillus casei. Organism_taxid: 1582. Strain: iam 12473. (2)

2a	2zqyA02	A:163-329
2b	2zqyB02	B:163-329
2c	2zqyD02	D:163-329
2d	2zqyC02	C:163-332

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: LDH_C (56)

Family: Ldh_1_C (51)

Lactobacillus casei (2)

1a	Ldh_1_C-2zqyD01	D:163-329
1b	Ldh_1_C-2zqyD02	D:163-329
1c	Ldh_1_C-2zqyD03	D:163-329
1d	Ldh_1_C-2zqyD04	D:163-329

Clan: NADP_Rossmann (1239)

Family: Ldh_1_N (51)

Lactobacillus casei (2)

2a	Ldh_1_N-2zqyD05	D:21-161
2b	Ldh_1_N-2zqyD06	D:21-161
2c	Ldh_1_N-2zqyD07	D:21-161
2d	Ldh_1_N-2zqyD08	D:21-161

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (LDH_LACCA | P00343)

molecular function
	GO:0004459	L-lactate dehydrogenase activity	Catalysis of the reaction: (S)-lactate + NAD+ = pyruvate + NADH + H+.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0019752	carboxylic acid metabolic process	The chemical reactions and pathways involving carboxylic acids, any organic acid containing one or more carboxyl (COOH) groups or anions (COO-).
	GO:0006096	glycolytic process	The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NO3	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asn A:138 - Pro A:139	[ RasMol ]
		Asn B:138 - Pro B:139	[ RasMol ]
		Asn C:138 - Pro C:139	[ RasMol ]
		Asn D:138 - Pro D:139	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2zqy
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LDH_LACCA \| P00343
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.27
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LDH_LACCA \| P00343
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LDH_LACCA \| P00343	:	1llc 2zqz 3vku 3vkv 3vpf

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (2, 8)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File