|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2Z6F) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2Z6F) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2Z6F) |
Exons (0, 0)| (no "Exon" information available for 2Z6F) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:112 aligned with ISDH_STAAM | Q931P4 from UniProtKB/Swiss-Prot Length:891 Alignment length:112 553 563 573 583 593 603 613 623 633 643 653 ISDH_STAAM 544 LTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDI 655 SCOP domains d2z6fa_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains NEAT-2z6fA01 A:544-655 Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------- Transcript 2z6f A 544 LTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDI 655 553 563 573 583 593 603 613 623 633 643 653
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2Z6F) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (ISDH_STAAM | Q931P4)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|