|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2YTB) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2YTB) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2YTB) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:42 aligned with ZNF32_HUMAN | P17041 from UniProtKB/Swiss-Prot Length:273 Alignment length:92 148 158 168 178 188 198 208 218 228 ZNF32_HUMAN 139 GKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRRVHSGEKPYRCDQCGKAFSQKGSLIVHIRVHTGLKPYACTQCRKSFHTRG 230 SCOP domains ----------------------------------------------d2ytba1 A:192-218 ------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) ----------------------------------------------------------------zf-H2C2_2-2----------------- Pfam domains (1) Pfam domains (2) ----------------------------------------------------------------zf-H2C2_2-2----------------- Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ZINC_FINGER_C2H2_-------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_ PROSITE Transcript 1 Exon 1.4c PDB: A:185-226 (gaps) UniProt: 24-273 [INCOMPLETE] Transcript 1 2ytb A 185 GSS----GS--------SG---------------------------GEKPYRCDQCGKAFSQKGSLIVHIRVHTGSGP-----------SSG 226 | ||- ||- - - |195 205 215 | - 224 | 188| 190| 192 223 224 187 189 191
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2YTB) |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (ZNF32_HUMAN | P17041)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|