|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2YSQ) |
Sites (0, 0)| (no "Site" information available for 2YSQ) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2YSQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2YSQ) |
SAPs(SNPs)/Variants (1, 1)
NMR Structure (1, 1)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (3, 3)
NMR Structure (3, 3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:81 aligned with ARHG9_HUMAN | O43307 from UniProtKB/Swiss-Prot Length:516 Alignment length:94 10 20 30 40 50 60 70 80 90 ARHG9_HUMAN 1 MTLLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEVEEGPSDVQNGHLDPNSDCLCLG 94 SCOP domains d2ysqa_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------SH3_1-2ysqA01 A:14-59 ----------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------A--------------------------------------- SAPs(SNPs) PROSITE -------SH3 PDB: A:8-67 UniProt: 8-67 --------------------------- PROSITE Transcript 1 1.2Exon 1.4 PDB: A:4-63 UniProt: 4-63 Exon 1.5 PDB: A:64-81 (gaps) Transcript 1 2ysq A 1 GSSGSSGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEVEEGSG--------PSS-----G 81 10 20 30 40 50 60 70 | - | | - | 77 78 | 81 80
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2YSQ) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (9, 9)|
NMR Structure(hide GO term definitions) Chain A (ARHG9_HUMAN | O43307)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|