Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF APOLIOPROTEIN M IN COMPLEX WITH SPHINGOSINE 1-PHOSPHATE
 
Authors :  C. Christoffersen, H. Obinata, S. Gowda, S. Galvani, J. Ahnstrom, M. Se C. Egerer-Sieber, Y. A. Muller, T. Hla, L. Nielsen, B. Dahlback
Date :  11 Apr 11  (Deposition) - 01 Jun 11  (Release) - 22 Jun 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Lipid Transport, Lipocalin, Hdl (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Christoffersen, H. Obinata, S. B. Kumaraswamy, S. Galvani, J. Ahnstrom, M. Sevvana, C. Egerer-Sieber, Y. A. Muller, T. Hla, L. B. Nielsen, B. Dahlback
Endothelium-Protective Sphingosine-1-Phosphate Provided By Hdl-Associated Apolipoprotein M.
Proc. Natl. Acad. Sci. Usa V. 108 9613 2011
PubMed-ID: 21606363  |  Reference-DOI: 10.1073/PNAS.1103187108

(-) Compounds

Molecule 1 - APOLIPOPROTEIN M
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPO-M, APOM, PROTEIN G3A

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
1FLC1Ligand/IonCITRATE ANION
2S1P2Ligand/Ion(2S,3R,4E)-2-AMINO-3-HYDROXYOCTADEC-4-EN-1-YLDIHYDROGEN PHOSPHATE
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1FLC1Ligand/IonCITRATE ANION
2S1P1Ligand/Ion(2S,3R,4E)-2-AMINO-3-HYDROXYOCTADEC-4-EN-1-YLDIHYDROGEN PHOSPHATE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1FLC-1Ligand/IonCITRATE ANION
2S1P1Ligand/Ion(2S,3R,4E)-2-AMINO-3-HYDROXYOCTADEC-4-EN-1-YLDIHYDROGEN PHOSPHATE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:63 , PHE A:71 , MET A:73 , ARG A:98 , TRP A:100 , TYR A:102 , LEU A:111 , ARG A:116 , LEU A:134 , GLU A:136 , TYR A:147 , FLC A:401 , HOH A:2026 , HOH A:2027 , HOH A:2061 , HOH A:2075 , HOH A:2091 , HOH A:2121 , ASN B:179BINDING SITE FOR RESIDUE S1P A 301
2AC2SOFTWAREARG A:116 , ASP A:118 , MET A:119 , TYR A:141 , S1P A:301 , HOH A:2027 , HOH A:2075 , HOH A:2088 , ASP B:67 , LYS B:91 , PRO B:177 , ASN B:179 , GLN B:180BINDING SITE FOR RESIDUE FLC A 401
3AC3SOFTWAREASP A:35 , GLY A:107 , SER A:108 , PHE B:63 , PHE B:71 , MET B:73 , ARG B:98 , TRP B:100 , TYR B:102 , LEU B:111 , ARG B:116 , GLU B:136 , ARG B:143 , TYR B:147 , HOH B:2046 , HOH B:2056 , HOH B:2061 , HOH B:2077 , HOH B:2078BINDING SITE FOR RESIDUE S1P B 301

(-) SS Bonds  (5, 5)

Asymmetric Unit
No.Residues
1A:23 -A:167
2A:95 -A:183
3A:128 -A:157
4B:95 -B:183
5B:128 -B:157

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2YG2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2YG2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2YG2)

(-) Exons   (0, 0)

(no "Exon" information available for 2YG2)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:163
 aligned with APOM_HUMAN | O95445 from UniProtKB/Swiss-Prot  Length:188

    Alignment length:166
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182      
           APOM_HUMAN    23 CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN 188
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..--..........-hhhhhh.eeeeeeeeee.hhhhhhhhh.eeeeeeeeee.....eeeeeeeeee....eeeeeeeeee......eee..eeeeeeeee......eeeeeeee..eeeeeeee.....hhhhhhhhhhhhhhh.................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2yg2 A  23 CP--SQLTTLGVDG-EFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN 188
                             |  |   32   | |  42        52        62        72        82        92       102       112       122       132       142       152       162       172       182      
                             | 27       36 |                                                                                                                                                      
                            24            38                                                                                                                                                      

Chain B from PDB  Type:PROTEIN  Length:151
 aligned with APOM_HUMAN | O95445 from UniProtKB/Swiss-Prot  Length:188

    Alignment length:157
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       
           APOM_HUMAN    29 LTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACEL 185
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ApoM-2   yg2B01 B:29-185                                                                                                                                      Pfam domains (1)
           Pfam domains (2) ApoM-2   yg2B02 B:29-185                                                                                                                                      Pfam domains (2)
         Sec.struct. author ......---hhhhhhheeeeeeeeee.hhhhhhhhh.eeeeeeeee.---..eeeeeeeeee....eeeeeeeee.......eee..eeeeeeeeee.....eeeeeeee..eeeeeeee.....hhhhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2yg2 B  29 LTTLGV---EFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAA---PMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACEL 185
                                 |  38        48        58        68      |  -|       88        98       108       118       128       138       148       158       168       178       
                                34  38                                   75  79                                                                                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2YG2)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2YG2)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: Calycin (163)

(-) Gene Ontology  (25, 25)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (APOM_HUMAN | O95445)
molecular function
    GO:0016209    antioxidant activity    Inhibition of the reactions brought about by dioxygen (O2) or peroxides. Usually the antioxidant is effective because it can itself be more easily oxidized than the substance protected. The term is often applied to components that can trap free radicals, thereby breaking the chain reaction that normally leads to extensive biological damage.
    GO:0005319    lipid transporter activity    Enables the directed movement of lipids into, out of or within a cell, or between cells.
    GO:0005543    phospholipid binding    Interacting selectively and non-covalently with phospholipids, a class of lipids containing phosphoric acid as a mono- or diester.
biological process
    GO:0098869    cellular oxidant detoxification    Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
    GO:0033344    cholesterol efflux    The directed movement of cholesterol, cholest-5-en-3-beta-ol, out of a cell or organelle.
    GO:0042632    cholesterol homeostasis    Any process involved in the maintenance of an internal steady state of cholesterol within an organism or cell.
    GO:0034380    high-density lipoprotein particle assembly    The non-covalent aggregation and arrangement of proteins and lipids to form a high-density lipoprotein particle.
    GO:0034384    high-density lipoprotein particle clearance    The process in which a high-density lipoprotein particle is removed from the blood via receptor-mediated endocytosis and its constituent parts degraded.
    GO:0034375    high-density lipoprotein particle remodeling    The acquisition, loss or modification of a protein or lipid within a high-density lipoprotein particle, including the hydrolysis of triglyceride by hepatic lipase, with the subsequent loss of free fatty acid, and the transfer of cholesterol esters from LDL to a triglyceride-rich lipoprotein particle by cholesteryl ester transfer protein (CETP), with the simultaneous transfer of triglyceride to LDL.
    GO:0006869    lipid transport    The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0042157    lipoprotein metabolic process    The chemical reactions and pathways involving any conjugated, water-soluble protein in which the covalently attached nonprotein group consists of a lipid or lipids.
    GO:0034445    negative regulation of plasma lipoprotein oxidation    Any process that stops, prevents, or reduces the frequency, rate or extent of lipoprotein particle oxidation, occurring in the blood plasma.
    GO:0009749    response to glucose    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
    GO:0001523    retinoid metabolic process    The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
    GO:0043691    reverse cholesterol transport    The directed movement of peripheral cell cholesterol, cholest-5-en-3-beta-ol, towards the liver for catabolism.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0034365    discoidal high-density lipoprotein particle    A newly formed high-density lipoprotein particle; consists of a phospholipid bilayer surrounded by two or more APOA1 molecules. The discoidal HDL particle is formed when lipid-free or lipid-poor APOA1 acquires phospholipids and unesterified cholesterol from either cell membranes or triglyceride-rich lipoproteins (undergoing lipolysis by lipoprotein lipase).
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0034364    high-density lipoprotein particle    A lipoprotein particle with a high density (typically 1.063-1.21 g/ml) and a diameter of 5-10 nm that contains APOAs and may contain APOCs and APOE; found in blood and carries lipids from body tissues to the liver as part of the reverse cholesterol transport process.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0034362    low-density lipoprotein particle    A lipoprotein particle, rich in cholesterol esters and low in triglycerides that is typically composed of APOB100 and APOE and has a density of 1.02-1.06 g/ml and a diameter of between 20-25 nm. LDL particles are formed from VLDL particles (via IDL) by the loss of triglyceride and gain of cholesterol ester. They transport endogenous cholesterol (and to some extent triglycerides) from peripheral tissues back to the liver.
    GO:0034366    spherical high-density lipoprotein particle    A mature high-density lipoprotein (HDL) particle, converted from discoidal HDL particles following the esterification of cholesterol in the particle by phosphatidylcholine-sterol O-acyltransferase (lecithin cholesterol acyltransferase; LCAT).
    GO:0034361    very-low-density lipoprotein particle    A triglyceride-rich lipoprotein particle that is typically composed of APOB100, APOE and APOCs and has a density of about 1.006 g/ml and a diameter of between 20-80 nm. It is found in blood and transports endogenous products (newly synthesized cholesterol and triglycerides) from the liver.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    S1P  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2yg2)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2yg2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  APOM_HUMAN | O95445
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  APOM_HUMAN | O95445
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        APOM_HUMAN | O954452wew 2wex

(-) Related Entries Specified in the PDB File

2wew CRYSTAL STRUCTURE OF HUMAN APOM IN COMPLEX WITH MYRISTIC ACID
2wex CRYSTAL STRUCTURE OF HUMAN APOM IN COMPLEX WITH GLYCEROL 1- MYRISTIC ACID