![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 1)
|
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 2YAL) |
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 2YAL) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 2YAL) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:39 aligned with SINR_BACSU | P06533 from UniProtKB/Swiss-Prot Length:111 Alignment length:69 50 60 70 80 90 100 SINR_BACSU 41 NPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQK 109 SCOP domains --------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------SIN PDB: A:75-103 UniProt: 65-103 ------ PROSITE Transcript --------------------------------------------------------------------- Transcript 2yal A 71 GPAI------------------------------DSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQK 109 | - - - | 80 90 100 74 75 Chain B from PDB Type:PROTEIN Length:38 aligned with SINR_BACSU | P06533 from UniProtKB/Swiss-Prot Length:111 Alignment length:68 50 60 70 80 90 100 SINR_BACSU 41 NPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQ 108 SCOP domains -------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------- CATH domains Pfam domains (1) ----------------------------------SinI-2yalB01 B:75-103 ----- Pfam domains (1) Pfam domains (2) ----------------------------------SinI-2yalB02 B:75-103 ----- Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------SIN PDB: B:75-103 UniProt: 65-103 ----- PROSITE Transcript -------------------------------------------------------------------- Transcript 2yal B 71 GPAI------------------------------DSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQ 108 | - - - | 80 90 100 74 75
|
(no "SCOP Domain" information available for 2YAL) |
(no "CATH Domain" information available for 2YAL) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (SINR_BACSU | P06533)
|
|
|
|
|
|
|