![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 5)
|
Asymmetric Unit (5, 5)
|
(no "SS Bond" information available for 1B0N) |
(no "Cis Peptide Bond" information available for 1B0N) |
(no "SAP(SNP)/Variant" information available for 1B0N) |
Asymmetric Unit (2, 2)
|
(no "Exon" information available for 1B0N) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:103 aligned with SINR_BACSU | P06533 from UniProtKB/Swiss-Prot Length:111 Alignment length:108 10 20 30 40 50 60 70 80 90 100 SINR_BACSU 1 MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQ 108 SCOP domains d1b0na2 A:1-68 SinR repressor, DNA-binding domain -----d1b0na1 A:74-108 SCOP domains CATH domains 1b0nA00 A:1-108 lambda repressor-like DNA-binding domains CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE -----HTH_CROC1 PDB: A:6-61 UniProt: 6-61 ---SIN PDB: A:65-103 UniProt: 65-103 ----- PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 1b0n A 1 MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHET-----LDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQ 108 10 20 30 40 50 60 | - | 80 90 100 68 74 Chain B from PDB Type:PROTEIN Length:31 aligned with SINI_BACSU | P23308 from UniProtKB/Swiss-Prot Length:57 Alignment length:31 18 28 38 SINI_BACSU 9 FELDQEWVELMVEAKEANISPEEIRKYLLLN 39 SCOP domains d1b0nb_ B: SinI anti-repressor SCOP domains CATH domains 1b0nB00 B:9-39 CATH domains Pfam domains ------------------------------- Pfam domains SAPs(SNPs) ------------------------------- SAPs(SNPs) PROSITE ------------------------------- PROSITE Transcript ------------------------------- Transcript 1b0n B 9 FELDQEWVELMVEAKEANISPEEIRKYLLLN 39 18 28 38
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1B0N) |
Asymmetric Unit(hide GO term definitions) Chain A (SINR_BACSU | P06533)
Chain B (SINI_BACSU | P23308)
|
|
|
|
|
|
|