1B0N - JenaLib

Title :   SINR PROTEIN/SINI PROTEIN COMPLEX

Authors :   R. J. Lewis, J. A. Brannigan, W. A. Offen, I. Smith, A. J. Wilkinson

Date :   11 Nov 98 (Deposition) - 13 Jan 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: A,B  (2x)
Biol. Unit 3: A,B  (2x)
Biol. Unit 4: A (2x),B (2x)
Biol. Unit 5: A (2x),B (2x)
Biol. Unit 6: A (2x),B (2x)

Keywords :   Transcription Regulator, Antagonist, Sporulation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. J. Lewis, J. A. Brannigan, W. A. Offen, I. Smith, A. J. Wilkinson
An Evolutionary Link Between Sporulation And Prophage Induction In The Structure Of A Repressor:Anti-Repressor Complex.
J. Mol. Biol. V. 283 907 1998
PubMed-ID: 9799632 | Reference-DOI: 10.1006/JMBI.1998.2163
(for further references see the PDB file header)

Compounds

Molecule 1 - PROTEIN (SINR PROTEIN)
	Cellular Location	:	CYTOPLASM
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Cellular Location	:	CYTOPLASM
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Gene	:	SINR, SINI
	Organism Scientific	:	BACILLUS SUBTILIS
	Organism Taxid	:	1423

Molecule 2 - PROTEIN (SINI PROTEIN)
	Cellular Location	:	CYTOPLASM
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Cellular Location	:	CYTOPLASM
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Gene	:	SINR, SINI
	Organism Scientific	:	BACILLUS SUBTILIS
	Organism Taxid	:	1423

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 5)

Asymmetric Unit (1, 5)

No.	Name	Count	Type	Full Name
1	ZN	5	Ligand/Ion	ZINC ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 3 (0, 0)

No.	Name	Count	Type	Full Name
1	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 4 (0, 0)

No.	Name	Count	Type	Full Name
1	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 5 (0, 0)

No.	Name	Count	Type	Full Name
1	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 6 (0, 0)

No.	Name	Count	Type	Full Name
1	ZN	-1	Ligand/Ion	ZINC ION

Sites (5, 5)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Asymmetric Unit (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_CROC1	PS50943	Cro/C1-type HTH domain profile.	SINR_BACSU	6-61	1	A:6-61
2	SIN	PS51500	Sin domain profile.	SINR_BACSU	65-103	1	A:65-103

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_CROC1	PS50943	Cro/C1-type HTH domain profile.	SINR_BACSU	6-61	1	A:6-61
2	SIN	PS51500	Sin domain profile.	SINR_BACSU	65-103	1	A:65-103

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_CROC1	PS50943	Cro/C1-type HTH domain profile.	SINR_BACSU	6-61	2	A:6-61
2	SIN	PS51500	Sin domain profile.	SINR_BACSU	65-103	2	A:65-103

Biological Unit 3 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_CROC1	PS50943	Cro/C1-type HTH domain profile.	SINR_BACSU	6-61	2	A:6-61
2	SIN	PS51500	Sin domain profile.	SINR_BACSU	65-103	2	A:65-103

Biological Unit 4 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_CROC1	PS50943	Cro/C1-type HTH domain profile.	SINR_BACSU	6-61	2	A:6-61
2	SIN	PS51500	Sin domain profile.	SINR_BACSU	65-103	2	A:65-103

Biological Unit 5 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_CROC1	PS50943	Cro/C1-type HTH domain profile.	SINR_BACSU	6-61	2	A:6-61
2	SIN	PS51500	Sin domain profile.	SINR_BACSU	65-103	2	A:65-103

Biological Unit 6 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_CROC1	PS50943	Cro/C1-type HTH domain profile.	SINR_BACSU	6-61	2	A:6-61
2	SIN	PS51500	Sin domain profile.	SINR_BACSU	65-103	2	A:65-103

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:103
 aligned with SINR_BACSU | P06533 from UniProtKB/Swiss-Prot  Length:111

    Alignment length:108
                                    10        20        30        40        50        60        70        80        90       100        
           SINR_BACSU     1 MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQ 108
               SCOP domains d1b0na2 A:1-68 SinR repressor, DNA-binding domain                   -----d1b0na1 A:74-108                    SCOP domains
               CATH domains 1b0nA00 A:1-108 lambda repressor-like DNA-binding domains                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhh...hhhhhhhh...hhhhhhhh........hhhhhhhhhhh...hhhhh......-----..hhhhhhhhhhhh....hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----HTH_CROC1  PDB: A:6-61 UniProt: 6-61                    ---SIN  PDB: A:65-103 UniProt: 65-103     ----- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1b0n A   1 MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHET-----LDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQ 108
                                    10        20        30        40        50        60       | -   |    80        90       100        
                                                                                              68    74

Chain B from PDB  Type:PROTEIN  Length:31
 aligned with SINI_BACSU | P23308 from UniProtKB/Swiss-Prot  Length:57

    Alignment length:31
                                    18        28        38 
           SINI_BACSU     9 FELDQEWVELMVEAKEANISPEEIRKYLLLN  39
               SCOP domains d1b0nb_ B: SinI anti-repressor  SCOP domains
               CATH domains 1b0nB00 B:9-39                  CATH domains
               Pfam domains ------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhh....hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------- PROSITE
                 Transcript ------------------------------- Transcript
                 1b0n B   9 FELDQEWVELMVEAKEANISPEEIRKYLLLN  39
                                    18        28        38

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (3, 3)

CATH Domains (2, 2)

Pfam Domains (0, 0)

Gene Ontology (7, 9)

Asymmetric Unit(hide GO term definitions)

Chain A (SINR_BACSU | P06533)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
biological process
	GO:0010629	negative regulation of gene expression	Any process that decreases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0030435	sporulation resulting in formation of a cellular spore	The process in which a relatively unspecialized cell acquires the specialized features of a cellular spore, a cell form that can be used for dissemination, for survival of adverse conditions because of its heat and dessication resistance, and/or for reproduction.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.

Chain B (SINI_BACSU | P23308)

molecular function
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
biological process
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1b0n)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1b0n
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SINI_BACSU \| P23308
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SINR_BACSU \| P06533
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SINI_BACSU \| P23308
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SINR_BACSU \| P06533
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description