Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CHROMATIN REMODELING FACTOR ISW1A(DEL_ATPASE) IN DNA COMPLEX
 
Authors :  K. Yamada, T. D. Frouws, B. Angst, D. J. Fitzgerald, C. Deluca, K. Schimm D. F. Sargent, T. J. Richmond
Date :  17 Feb 11  (Deposition) - 20 Apr 11  (Release) - 28 Mar 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.60
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Transcription, Nuclear Protein-Dna Complex, Chromatin Remodeling, Nucleosome Remodeling (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Yamada, T. D. Frouws, B. Angst, D. J. Fitzgerald, C. Deluca, K. Schimmele, D. F. Sargent, T. J. Richmond
Structure And Mechanism Of The Chromatin Remodelling Factor Isw1A
Nature V. 472 448 2011
PubMed-ID: 21525927  |  Reference-DOI: 10.1038/NATURE09947

(-) Compounds

Molecule 1 - IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
    ChainsA
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System CommonFALL ARMYWORM
    Expression System PlasmidMULTIBAC
    Expression System StrainSF21
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentHAND, SANT, SLIDE DOMAINS, RESIDUES 763-1129
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymISWI CHROMATIN-REMODELING COMPLEX ATPASE ISW1, ISW1
 
Molecule 2 - ISWI ONE COMPLEX PROTEIN 3
    ChainsB
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System CommonFALL ARMYWORM
    Expression System PlasmidMULTIBAC
    Expression System StrainSF21
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentCORE DOMAIN CONTAINING CLB AND HLB SUBDOMAINS, RESIDUES 127-749
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymIOC3
 
Molecule 3 - I-DNA/E-DNA
    ChainsC, D, E, F
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Other Details48 BASES, C-D I-DNA DUPLEX, E-F E-DNA DUPLEX
    SyntheticYES

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2Y9Z)

(-) Sites  (0, 0)

(no "Site" information available for 2Y9Z)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Y9Z)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2Y9Z)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Y9Z)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SANTPS51293 SANT domain profile.ISW1_YEAST882-935  1A:882-935

(-) Exons   (0, 0)

(no "Exon" information available for 2Y9Z)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:287
 aligned with ISW1_YEAST | P38144 from UniProtKB/Swiss-Prot  Length:1129

    Alignment length:287
                                   798       808       818       828       838       848       858       868       878       888       898       908       918       928       938       948       958       968       978       988       998      1008      1018      1028      1038      1048      1058      1068       
          ISW1_YEAST    789 RSSTPSHPRMPKPHVFHSHQLQPPQLKVLYEKERMWTAKKTGYVPTMDDVKAAYGDISDEEEKKQKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDATKDRMKKED 1075
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains HAND-2y9zA01 A:789-883                                                                         --------------------------------------------------------SLIDE-2y9zA02 A:940-1058                                                                                               ----------------- Pfam domains
         Sec.struct. author .........................hhhhhhhhhhhhhh.......................hhhhhhhhhhhh.......hhhhhhhhhhhhh......hhhhhhhhhhhhhh....hhhhh........hhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhh.........................hhhhhhhhhhhhhh.......hhhhhhhhhh.......hhhhh..hhhhhhhhhhhhhhhh..................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------SANT  PDB: A:882-935 UniProt: 882-935                 -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2y9z A  789 RSSTPSHPRMPKPHVFHSHQLQPPQLKVLYEKERMWTAKKTGYVPTMDDVKAAYGDISDEEEKKQKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDATKDRMKKED 1075
                                   798       808       818       828       838       848       858       868       878       888       898       908       918       928       938       948       958       968       978       988       998      1008      1018      1028      1038      1048      1058      1068       

Chain B from PDB  Type:PROTEIN  Length:595
 aligned with IOC3_YEAST | P43596 from UniProtKB/Swiss-Prot  Length:787

    Alignment length:615
                                   143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733       743     
          IOC3_YEAST    134 AHEQVEPALIPSNWTSVIPLLTSDFKNQYSVISRLKNPNMKPVPYAGDIIKLMAFINKFSSFFHSDLQNLSFQDFEVGLDLYPGDPNGSAAGIVKGPEDTSLLLYPDFMAIKDIVYCQDKMNLLFLSLLDLTFTENFDGKSAKKKGPLTTWENLKSSSKKVFSNPLYRLRLVAREWGYPREWRQQLPSDQDISKPKTALFEQDEQTPVVDPSHPEILTPNIYTWNANEPLPLESNPLYNREMDKNGILALKPMDRVVLLRALTDWCASHSSAIHDEIYKLTHGKKDPVFGIQTQQVPRYTIEGVDNTINQFKKLCSLIQSRYEIRSKKKHFVKQLKEGKKPDLSRKLEILKEIKAELKNAVKSEKDELLFSLYDKWVPLFEGELPDQPLANPFSERLYKLRLQEFFLGRVPHIGDFYMPRLHSYGDSLEMSTFTDLRNLQALLSKFKNNEYNAFTLFENDGQSMSAQFKLFYHDTPSLAHDVARGRNTSGKVYWYELCHDSATLLEFLEFLDYKIVKPQDEKKEGNEKEKEALNNEAHILEQKSTTDNNPSINTNPLPKDAKYNTARKKLQILKEFLSDYYFILRQFEQMKVQFADMKPGKRQLRRIQRQTVNYN  748
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................................hhhhhhhhhhhhh.............hhhhhhhh................................hhhhhhhhhhhhhhhhhhhhh..................hhhhh....hhhhhhhhhhhhhhhhh...........................................................................hhhhhhhhhhhhhhhhhh.hhhhhhhhhhh......................hhhhhhhhhhhhhhhhh.......hhhhhh......hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhh.........................eeeee...eeee..................hhhhhhhhhhhh.......................eee.hhhhhhhhhh.........eee....hhhhhhhhhhhhhhh.........--------------------...................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2y9z B  134 AHEQVEPALIPSNWTSVIPLLTSDFKNQYSVISRLKNPNMKPVPYAGDIIKLMAFINKFSSFFHSDLQNLSFQDFEVGLDLYPGDPNGSAAGIVKGPEDTSLLLYPDFMAIKDIVYCQDKMNLLFLSLLDLTFTENFDGKSAKKKGPLTTWENLKSSSKKVFSNPLYRLRLVAREWGYPREWRQQLPSDQDISKPKTALFEQDEQTPVVDPSHPEILTPNIYTWNANEPLPLESNPLYNREMDKNGILALKPMDRVVLLRALTDWCASHSSAIHDEIYKLTHGKKDPVFGIQTQQVPRYTIEGVDNTINQFKKLCSLIQSRYEIRSKKKHFVKQLKEGKKPDLSRKLEILKEIKAELKNAVKSEKDELLFSLYDKWVPLFEGELPDQPLANPFSERLYKLRLQEFFLGRVPHIGDFYMPRLHSYGDSLEMSTFTDLRNLQALLSKFKNNEYNAFTLFENDGQSMSAQFKLFYHDTPSLAHDVARGRNTSGKVYWYELCHDSATLLEFLEFLDYKIVKPQDEKKE--------------------TTDNNPSINTNPLPKDAKYNTARKKLQILKEFLSDYYFILRQFEQMKVQFADMKPGKRQLRRIQRQTVNYN  748
                                   143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653   |     -         -    |  683       693       703       713       723       733       743     
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     657                  678                                                                      

Chain C from PDB  Type:DNA  Length:31
                                                                
                2y9z C    8 AACCCGTATATAAGCCTAGGCTTATATACGG   38
                                    17        27        37 

Chain D from PDB  Type:DNA  Length:31
                                                                
                2y9z D   11 CCGTATATAAGCCTAGGCTTATATACGGGTT   41
                                    20        30        40 

Chain E from PDB  Type:DNA  Length:23
                                                        
                2y9z E   25 AGGCTTATATACGGGTTCATGCG   47
                                    34        44   

Chain F from PDB  Type:DNA  Length:23
                                                        
                2y9z F    2 CGCATGAACCCGTATATAAGCCT   24
                                    11        21   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2Y9Z)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2Y9Z)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (30, 39)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (ISW1_YEAST | P38144)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016818    hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides    Catalysis of the hydrolysis of any acid anhydride which contains phosphorus.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0031491    nucleosome binding    Interacting selectively and non-covalently with a nucleosome, a complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0000182    rDNA binding    Interacting selectively and non-covalently with DNA sequences encoding ribosomal RNA.
    GO:0044212    transcription regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
biological process
    GO:0043044    ATP-dependent chromatin remodeling    Dynamic structural changes to eukaryotic chromatin that require energy from the hydrolysis of ATP, ranging from local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation, mediated by ATP-dependent chromatin-remodelling factors.
    GO:0006354    DNA-templated transcription, elongation    The extension of an RNA molecule after transcription initiation and promoter clearance at a DNA-dependent RNA polymerase promoter by the addition of ribonucleotides catalyzed by an RNA polymerase.
    GO:0006338    chromatin remodeling    Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
    GO:0070870    heterochromatin maintenance involved in chromatin silencing    A chromatin organization process that preserves heterochromatin in a stable functional or structural state, and that contributes to chromatin silencing.
    GO:1900050    negative regulation of histone exchange    Any process that stops, prevents or reduces the frequency, rate or extent of histone exchange.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:1902275    regulation of chromatin organization    Any process that modulates the frequency, rate or extent of chromatin organization.
    GO:0060303    regulation of nucleosome density    Any process that modulates the number of nucleosomes in a given region of a chromosome.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0001178    regulation of transcriptional start site selection at RNA polymerase II promoter    Any process that modulates the rate, frequency or extent of a process involved in the selection of the specific location within the template strand of an RNA polymerase II promoter for hybridization of the cognate ribonucleotides and formation of first phosphodiester bond within the nascent transcript.
    GO:0006363    termination of RNA polymerase I transcription    The process in which the synthesis of an RNA molecule by RNA polymerase I using a DNA template is completed. RNAP I termination requires binding of a terminator protein so specific sequences downstream of the transcription unit.
    GO:0006369    termination of RNA polymerase II transcription    The process in which the synthesis of an RNA molecule by RNA polymerase II using a DNA template is completed.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0036436    Isw1a complex    An Isw1 complex that binds DNA and has nucleosome-stimulated ATPase activity. In S. cerevisiae, contains an Isw1p ATPase subunit in complex with Ioc3p.
    GO:0036437    Isw1b complex    An Isw1 complex that binds DNA and has nucleosome-stimulated ATPase activity. In S. cerevisiae, contains an Isw1p ATPase subunit in complex with Ioc2p and Ioc4p.
    GO:0016589    NURF complex    An ISWI complex that contains an ATPase subunit of the ISWI family (SNF2L in mammals), a NURF301 homolog (BPTF in humans), and additional subunits, though the composition of these additional subunits varies slightly with species. NURF is involved in regulation of transcription from TRNA polymerase II promoters.
    GO:0030874    nucleolar chromatin    The portion of nuclear chromatin associated with the nucleolus; includes the DNA encoding the ribosomal RNA.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B   (IOC3_YEAST | P43596)
molecular function
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0031491    nucleosome binding    Interacting selectively and non-covalently with a nucleosome, a complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006338    chromatin remodeling    Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0036436    Isw1a complex    An Isw1 complex that binds DNA and has nucleosome-stimulated ATPase activity. In S. cerevisiae, contains an Isw1p ATPase subunit in complex with Ioc3p.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2y9z)
 
  Sites
(no "Sites" information available for 2y9z)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2y9z)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2y9z
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IOC3_YEAST | P43596
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ISW1_YEAST | P38144
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IOC3_YEAST | P43596
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ISW1_YEAST | P38144
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IOC3_YEAST | P435962y9y
        ISW1_YEAST | P381442y9y

(-) Related Entries Specified in the PDB File

2y9y CHROMATIN REMODELING FACTOR ISW1A(DEL_ATPASE)