2Y9Y - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:277
 aligned with ISW1_YEAST | P38144 from UniProtKB/Swiss-Prot  Length:1129

    Alignment length:277
                                   800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060       
          ISW1_YEAST    791 STPSHPRMPKPHVFHSHQLQPPQLKVLYEKERMWTAKKTGYVPTMDDVKAAYGDISDEEEKKQKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDAT 1067
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains HAND-2y9yA01 A:791-883                                                                       --------------------------------------------------------SLIDE-2y9yA02 A:940-1058                                                                                               --------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhh.......................hhhhhhhhhhhh.......hhhhhhhhhhhhh......hhhhhhhhhhhhhh....hhhhh........hhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhh.........................hhhhhhhhhhhhhh.......hhhhhhhhhh.......hhhhh..hhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------SANT  PDB: A:882-935 UniProt: 882-935                 ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2y9y A  791 STPSHPRMPKPHVFHSHQLQPPQLQVLYEKERMWTAKKTGYVPTMDDVKAAYGKISDQEEQKEKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDAT 1067
                                   800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060

Chain B from PDB  Type:PROTEIN  Length:592
 aligned with IOC3_YEAST | P43596 from UniProtKB/Swiss-Prot  Length:787

    Alignment length:609
                                   147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737         
          IOC3_YEAST    138 VEPALIPSNWTSVIPLLTSDFKNQYSVISRLKNPNMKPVPYAGDIIKLMAFINKFSSFFHSDLQNLSFQDFEVGLDLYPGDPNGSAAGIVKGPEDTSLLLYPDFMAIKDIVYCQDKMNLLFLSLLDLTFTENFDGKSAKKKGPLTTWENLKSSSKKVFSNPLYRLRLVAREWGYPREWRQQLPSDQDISKPKTALFEQDEQTPVVDPSHPEILTPNIYTWNANEPLPLESNPLYNREMDKNGILALKPMDRVVLLRALTDWCASHSSAIHDEIYKLTHGKKDPVFGIQTQQVPRYTIEGVDNTINQFKKLCSLIQSRYEIRSKKKHFVKQLKEGKKPDLSRKLEILKEIKAELKNAVKSEKDELLFSLYDKWVPLFEGELPDQPLANPFSERLYKLRLQEFFLGRVPHIGDFYMPRLHSYGDSLEMSTFTDLRNLQALLSKFKNNEYNAFTLFENDGQSMSAQFKLFYHDTPSLAHDVARGRNTSGKVYWYELCHDSATLLEFLEFLDYKIVKPQDEKKEGNEKEKEALNNEAHILEQKSTTDNNPSINTNPLPKDAKYNTARKKLQILKEFLSDYYFILRQFEQMKVQFADMKPGKRQLRRIQRQTVN  746
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........................................hhhhhhhhhhhhh.............hhhhhhhh................................hhhhhhhhhhhhhhhhhhhhh..................hhhhh....hhhhhhhhhhhhhhhhh...........................................................................hhhhhhhhhhhhhhhhhh.hhhhhhhhhhh......................hhhhhhhhhhhhhhhhh.......hhhhhh......hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhh.........................eeeee...eeee..................hhhhhhhhhhhh.......................eee.hhhhhhhhhh.........eee....hhhhhhhhhhhhhhh.............-----------------..................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2y9y B  138 VEPALIPSNWTSVIPLLTSDFKNQYSVISRLKNPNMKPVPYAGDIIKLMAFINKFSSFFHSDLQNLSFQDFEVGLDLYPGDPNGSAAGIVKGPEDTSLLLYPDFMAIKDIVYCQDKMNLLFLSLLDLTFTENFDGKSAKKKGPLTTWENLKSSSKKVFSNPLYRLRLVAREWGYPREWRQQLPSDQDISKPKTALFEQDEQTPVVDPSHPEILTPNIYTWNANEPLPLESNPLYNREMDKNGILALKPMDRVVLLRALTDWCASHSSAIHDEIYKLTHGKKDPVFGIQTQQVPRYTIEGVDNTINQFKKLCSLIQSRYEIRSKKKHFVKQLKEGKKPDLSRKLEILKEIKAELKNAVKSEKDELLFSLYDKWVPLFEGELPDQPLANPFSERLYKLRLQEFFLGRVPHIGDFYMPRLHSYGDSLEMSTFTDLRNLQALLSKFKNNEYNAFTLFENDGQSMSAQFKLFYHDTPSLAHDVARGRNTSGKVYWYELCHDSATLLEFLEFLDYKIVKPQDEKKEGNEK-----------------TDNKPSINTNPLPKDAKYNTARKKLQILKEFLSDYYFILRQFEQMKVQFADMKPGKRQLRRIQRQTVN  746
                                   147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657   |     -         - |     687       697       707       717       727       737         
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     661               679

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (ISW1_YEAST | P38144)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0004386	helicase activity	Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016818	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides	Catalysis of the hydrolysis of any acid anhydride which contains phosphorus.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0031491	nucleosome binding	Interacting selectively and non-covalently with a nucleosome, a complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0000182	rDNA binding	Interacting selectively and non-covalently with DNA sequences encoding ribosomal RNA.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
biological process
	GO:0043044	ATP-dependent chromatin remodeling	Dynamic structural changes to eukaryotic chromatin that require energy from the hydrolysis of ATP, ranging from local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation, mediated by ATP-dependent chromatin-remodelling factors.
	GO:0006354	DNA-templated transcription, elongation	The extension of an RNA molecule after transcription initiation and promoter clearance at a DNA-dependent RNA polymerase promoter by the addition of ribonucleotides catalyzed by an RNA polymerase.
	GO:0006338	chromatin remodeling	Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
	GO:0070870	heterochromatin maintenance involved in chromatin silencing	A chromatin organization process that preserves heterochromatin in a stable functional or structural state, and that contributes to chromatin silencing.
	GO:1900050	negative regulation of histone exchange	Any process that stops, prevents or reduces the frequency, rate or extent of histone exchange.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:1902275	regulation of chromatin organization	Any process that modulates the frequency, rate or extent of chromatin organization.
	GO:0060303	regulation of nucleosome density	Any process that modulates the number of nucleosomes in a given region of a chromosome.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0001178	regulation of transcriptional start site selection at RNA polymerase II promoter	Any process that modulates the rate, frequency or extent of a process involved in the selection of the specific location within the template strand of an RNA polymerase II promoter for hybridization of the cognate ribonucleotides and formation of first phosphodiester bond within the nascent transcript.
	GO:0006363	termination of RNA polymerase I transcription	The process in which the synthesis of an RNA molecule by RNA polymerase I using a DNA template is completed. RNAP I termination requires binding of a terminator protein so specific sequences downstream of the transcription unit.
	GO:0006369	termination of RNA polymerase II transcription	The process in which the synthesis of an RNA molecule by RNA polymerase II using a DNA template is completed.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0036436	Isw1a complex	An Isw1 complex that binds DNA and has nucleosome-stimulated ATPase activity. In S. cerevisiae, contains an Isw1p ATPase subunit in complex with Ioc3p.
	GO:0036437	Isw1b complex	An Isw1 complex that binds DNA and has nucleosome-stimulated ATPase activity. In S. cerevisiae, contains an Isw1p ATPase subunit in complex with Ioc2p and Ioc4p.
	GO:0016589	NURF complex	An ISWI complex that contains an ATPase subunit of the ISWI family (SNF2L in mammals), a NURF301 homolog (BPTF in humans), and additional subunits, though the composition of these additional subunits varies slightly with species. NURF is involved in regulation of transcription from TRNA polymerase II promoters.
	GO:0030874	nucleolar chromatin	The portion of nuclear chromatin associated with the nucleolus; includes the DNA encoding the ribosomal RNA.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (IOC3_YEAST | P43596)

molecular function
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0031491	nucleosome binding	Interacting selectively and non-covalently with a nucleosome, a complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006338	chromatin remodeling	Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0036436	Isw1a complex	An Isw1 complex that binds DNA and has nucleosome-stimulated ATPase activity. In S. cerevisiae, contains an Isw1p ATPase subunit in complex with Ioc3p.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (2, 2)

Gene Ontology (30, 39)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File