|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric Unit (3, 3) Biological Unit 1 (3, 6) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2XLH) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2XLH) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2XLH) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2XLH) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:126 aligned with CYCP_ALCXX | P00138 from UniProtKB/Swiss-Prot Length:127 Alignment length:126 10 20 30 40 50 60 70 80 90 100 110 120 CYCP_ALCXX 1 QFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK 126 SCOP domains d2xlha_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains -----Cytochrom_C_2-2xlhA01 A:6-124 -- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------CYTCII PDB: A:7-125 UniProt: 7-125 - PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript 2xlh A 1 xFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYAKK 126 | 10 20 30 40 50 60 70 80 90 100 110 120 | 1-PCA
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2XLH) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A (CYCP_ALCXX | P00138)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|