|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 6)| Asymmetric/Biological Unit (3, 6) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2X2P) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2X2P) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2X2P) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2X2P) |
Exons (0, 0)| (no "Exon" information available for 2X2P) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:117 aligned with Q81G57_BACCR | Q81G57 from UniProtKB/TrEMBL Length:119 Alignment length:117 10 20 30 40 50 60 70 80 90 100 110 Q81G57_BACCR 1 MLVAYDSMTGNVKRFIHKLNMPAVQIDEDLVIDEDFILITYTTGFGNVPERVLDFLERNNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVEYFKERVREIA 117 SCOP domains --------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2x2pA00 A:1-117 [code=3.40.50.360, no name defined] CATH domains Pfam domains --Flavodoxin_NdrI-2x2pA01 A:3-111 ------ Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------- Transcript 2x2p A 1 MLVAYDSMTGNVKRFIHKLNMPAVQIDEDLVIDEDFILITYTTGFGNVPERVLDFLERNNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVEYFKERVREIA 117 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2X2P) |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q81G57_BACCR | Q81G57)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|