|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2W9O) |
Sites (0, 0)| (no "Site" information available for 2W9O) |
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2W9O) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2W9O) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2W9O) |
Exons (0, 0)| (no "Exon" information available for 2W9O) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with DIS_PROJR | Q7ZZM2 from UniProtKB/Swiss-Prot Length:110 Alignment length:55 65 75 85 95 105 DIS_PROJR 56 PMKGNTLQKLPLCTTGPCCRQCKLKPAGTTCWRTSVSSHYCTGRSCECPSYPGNG 110 SCOP domains d2w 9oa_ A: automated matches SCOP domains CATH domains 2w9 oA00 A:1-46 Echistatin CATH domains Pfam domains ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------- PROSITE Transcript ------------------------------------------------------- Transcript 2w9o A 1 AMD---------CTTGPCCRQCKLKPAGTTCWRTSVSSHYCTGRSCECPSYPGNG 46 | - | 11 21 31 41 3 4
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2W9O) |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (DIS_PROJR | Q7ZZM2)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|