2V4Z - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   THE CRYSTAL STRUCTURE OF THE HUMAN G-PROTEIN SUBUNIT ALPHA ( GNAI3) IN COMPLEX WITH AN ENGINEERED REGULATOR OF G-PROTEIN SIGNALING TYPE 2 DOMAIN (RGS2)

Authors :   A. K. Roos, M. Soundararajan, A. C. W. Pike, C. H. Arrowsmith, J. Weigelt A. Edwards, C. Bountra, S. Knapp

Date :   30 Sep 08 (Deposition) - 04 Nov 08 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym./Biol. Unit : A,B

Keywords :   Gtp Hydrolysis, Adp-Ribosylation, Nucleotide-Binding, Lipoprotein, Gtp-Binding, Phosphoprotein, Signal Transduction Inhibitor, Guanine Nucleotide Binding Protein, Transmembrane Signaling, G-Protein Coupled Receptor, Palmitate, Myristate, Transducer, Cell Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. J. Kimple, M. Soundararajan, S. Q. Hutsell, A. K. Roos, D. J. Urban, V. Setola, B. R. Temple, B. L. Roth, S. Knapp, F. S. Willard, D. P. Siderovski
Structural Determinants Of G-Protein Alpha Subunit Selectivity By Regulator Of G-Protein Signaling 2(Rgs2).
J. Biol. Chem. V. 284 19402 2009
PubMed-ID: 19478087 | Reference-DOI: 10.1074/JBC.M109.024711

Molecule 1 - GUANINE NUCLEOTIDE-BINDING PROTEIN G(K) SUBUNIT ALPHA
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PNIC28-BSA4
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Variant	:	R3-PRARE2
	Fragment	:	SUBUNIT ALPHA, RESIDUES 4-350
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	G(I) ALPHA-3, GUANINE NUCLEOTIDE-BINDING PROTEIN G K SUBUNIT ALPHA G I ALPHA-3

Molecule 2 - REGULATOR OF G-PROTEIN SIGNALING 2
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-LIC
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Variant	:	R3-PRARE2
	Fragment	:	RGS DOMAIN, RESIDUES 71-209
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	G0/G1 SWITCH REGULATORY PROTEIN 8, RGS2, CELL GROWTH-INHIBITING GENE 31 PROTEIN

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 3)

No.	Name	Count	Type	Full Name
1	ALF	1	Ligand/Ion	TETRAFLUOROALUMINATE ION
2	GDP	1	Ligand/Ion	GUANOSINE-5'-DIPHOSPHATE
3	MG	1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLU A:43 , SER A:44 , GLY A:45 , LYS A:46 , SER A:47 , THR A:48 , ASP A:150 , SER A:151 , LEU A:175 , ARG A:176 , THR A:177 , ARG A:178 , ASN A:269 , LYS A:270 , ASP A:272 , LEU A:273 , CYS A:325 , ALA A:326 , THR A:327 , ALF A:1349 , MG A:1350 , HOH A:2002 , HOH A:2015 , HOH A:2016	BINDING SITE FOR RESIDUE GDP A1348
2	AC2	SOFTWARE	GLY A:42 , GLU A:43 , LYS A:46 , ARG A:178 , LYS A:180 , THR A:181 , VAL A:201 , GLY A:203 , GLN A:204 , GDP A:1348 , MG A:1350 , HOH A:2002 , HOH A:2012 , HOH A:2015	BINDING SITE FOR RESIDUE ALF A1349
3	AC3	SOFTWARE	SER A:47 , THR A:181 , GDP A:1348 , ALF A:1349 , HOH A:2002 , HOH A:2015	BINDING SITE FOR RESIDUE MG A1350

(no "SS Bond" information available for 2V4Z)

Asymmetric/Biological Unit

No.	Residues
1	Glu A:116	-	Gly A:117
2	Ser B:73	-	Pro B:74

Asymmetric/Biological Unit (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_068558	G	40	R	GNAI3_HUMAN	Disease (ARCND1)	387907178	A	G	40	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS2_HUMAN	83-199	1	B:83-199

Asymmetric/Biological Unit (11, 11)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000235382	1b	ENSE00000869804	chr1:192778171-192778311	141	RGS2_HUMAN	1-37	37	0	-	-
1.3a	ENST00000235382	3a	ENSE00000790950	chr1:192779296-192779397	102	RGS2_HUMAN	37-71	35	0	-	-
1.3d	ENST00000235382	3d	ENSE00000790951	chr1:192779500-192779561	62	RGS2_HUMAN	71-92	22	1	B:72-92	21
1.4b	ENST00000235382	4b	ENSE00000790952	chr1:192780111-192780277	167	RGS2_HUMAN	92-147	56	1	B:92-147 (gaps)	56
1.5	ENST00000235382	5	ENSE00000869805	chr1:192780532-192781403	872	RGS2_HUMAN	148-211	64	1	B:148-199 (gaps)	52

2.1	ENST00000369851	1	ENSE00001451089	chr1:110091233-110091460	228	GNAI3_HUMAN	1-40	40	1	A:32-40	9
2.2	ENST00000369851	2	ENSE00001781395	chr1:110116359-110116401	43	GNAI3_HUMAN	40-54	15	1	A:40-54	15
2.3	ENST00000369851	3	ENSE00000783439	chr1:110116518-110116659	142	GNAI3_HUMAN	54-101	48	1	A:54-101	48
2.4	ENST00000369851	4	ENSE00000826739	chr1:110121826-110121983	158	GNAI3_HUMAN	102-154	53	1	A:102-154	53
2.5	ENST00000369851	5	ENSE00000826740	chr1:110125059-110125187	129	GNAI3_HUMAN	154-197	44	1	A:154-197	44
2.6	ENST00000369851	6	ENSE00001740751	chr1:110128838-110128967	130	GNAI3_HUMAN	197-240	44	1	A:197-240	44
2.7	ENST00000369851	7	ENSE00001756567	chr1:110129351-110129504	154	GNAI3_HUMAN	241-292	52	1	A:241-292	52
2.8	ENST00000369851	8	ENSE00000913041	chr1:110134665-110134877	213	GNAI3_HUMAN	292-354	63	1	A:292-347	56
2.9	ENST00000369851	9	ENSE00001342841	chr1:110134967-110136975	2009	GNAI3_HUMAN	-	0	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:316
 aligned with GNAI3_HUMAN | P08754 from UniProtKB/Swiss-Prot  Length:354

    Alignment length:316
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341      
          GNAI3_HUMAN    32 KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNN 347
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2v4zA01 A:32-61,A:181-347     2v4zA02 A:62-180 GI Alpha 1, domain 2-like                                                                             2v4zA01 A:32-61,A:181-347 P-loop containing nucleotide triphosphate hydrolases                                                                                          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh......hhhhhhhh......eeeeeee....eeeeeee..hhhhhhhhhhhh....eeeeeee.hhhhh........hhhhhhhhhhhhhhhhhhhh..eeeeeeehhhhhhhhh...hhhhh........hhhhhhhhhhhhhhh.........eeeee....hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------R------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.1 -------------Exon 2.3  PDB: A:54-101 UniProt: 54-101         Exon 2.4  PDB: A:102-154 UniProt: 102-154            ------------------------------------------Exon 2.6  PDB: A:197-240 UniProt: 197-240   Exon 2.7  PDB: A:241-292 UniProt: 241-292           ------------------------------------------------------- Transcript 2 (1)
           Transcript 2 (2) --------Exon 2.2       ---------------------------------------------------------------------------------------------------Exon 2.5  PDB: A:154-197 UniProt: 154-197   ----------------------------------------------------------------------------------------------Exon 2.8  PDB: A:292-347 UniProt: 292-354 [INCOMPLETE]   Transcript 2 (2)
                 2v4z A  32 KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNN 347
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341

Chain B from PDB  Type:PROTEIN  Length:122
 aligned with RGS2_HUMAN | P41220 from UniProtKB/Swiss-Prot  Length:211

    Alignment length:128
                                    81        91       101       111       121       131       141       151       161       171       181       191        
           RGS2_HUMAN    72 PSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLC 199
               SCOP domains d2v4zb_ B: automated matches                                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh---hhhhhhhhhhhhhhhhh..........hhhhhhhhhhh---.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------RGS  PDB: B:83-199 UniProt: 83-199                                                                                    PROSITE
           Transcript 1 (1) Exon 1.3d            -------------------------------------------------------Exon 1.5  PDB: B:148-199 (gaps) UniProt: 148-211     Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.4b  PDB: B:92-147 (gaps) UniProt: 92-147         ---------------------------------------------------- Transcript 1 (2)
                 2v4z B  72 PSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFSEENIEFWLACEDFK---SPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQN---ATSGCFTTAQKRVYSLMENDSYPRFLKSEFYQDLC 199
                                    81        91       101       111        |-  |    131       141       151       161   |   171       181       191        
                                                                          120 124                                  161 165

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Regulator of G-protein signaling, RGS (52)

Superfamily: Regulator of G-protein signaling, RGS (52)

Family: Regulator of G-protein signaling, RGS (27)

Protein domain: automated matches (6)

Human (Homo sapiens) [TaxId: 9606] (3)

d2v4zb_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Human (Homo sapiens) (413)

2v4zA01

A:32-61,A:181-347

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: GI Alpha 1, domain 2-like (67)

Homologous Superfamily: GI Alpha 1, domain 2-like (66)

Human (Homo sapiens) (13)

2v4zA02

A:62-180

(no "Pfam Domain" information available for 2V4Z)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (GNAI3_HUMAN | P08754)

molecular function
	GO:0031683	G-protein beta/gamma-subunit complex binding	Interacting selectively and non-covalently with a complex of G-protein beta/gamma subunits.
	GO:0001664	G-protein coupled receptor binding	Interacting selectively and non-covalently with a G-protein coupled receptor.
	GO:0031821	G-protein coupled serotonin receptor binding	Interacting selectively and non-covalently with a metabotropic serotonin receptor.
	GO:0019003	GDP binding	Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0032794	GTPase activating protein binding	Interacting selectively and non-covalently with a GTPase activating protein.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0019001	guanyl nucleotide binding	Interacting selectively and non-covalently with guanyl nucleotides, any compound consisting of guanosine esterified with (ortho)phosphate.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0046039	GTP metabolic process	The chemical reactions and pathways involving GTP, guanosine triphosphate.
	GO:0007193	adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway	The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds through inhibition of adenylyl cyclase activity and a subsequent decrease in the concentration of cyclic AMP (cAMP).
	GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds through activation or inhibition of adenylyl cyclase activity and a subsequent change in the concentration of cyclic AMP (cAMP).
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0007212	dopamine receptor signaling pathway	The series of molecular signals generated as a consequence of a dopamine receptor binding to one of its physiological ligands.
	GO:0007194	negative regulation of adenylate cyclase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of adenylate cyclase activity.
	GO:0006457	protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0006906	vesicle fusion	Fusion of the membrane of a transport vesicle with its target membrane.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005834	heterotrimeric G-protein complex	Any of a family of heterotrimeric GTP-binding and hydrolyzing proteins; they belong to a superfamily of GTPases that includes monomeric proteins such as EF-Tu and RAS. Heterotrimeric G-proteins consist of three subunits; the alpha subunit contains the guanine nucleotide binding site and possesses GTPase activity; the beta and gamma subunits are tightly associated and function as a beta-gamma heterodimer; extrinsic plasma membrane proteins (cytoplasmic face) that function as a complex to transduce signals from G-protein coupled receptors to an effector protein.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0030496	midbody	A thin cytoplasmic bridge formed between daughter cells at the end of cytokinesis. The midbody forms where the contractile ring constricts, and may persist for some time before finally breaking to complete cytokinesis.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0042588	zymogen granule	A membrane-bounded, cytoplasmic secretory granule found in enzyme-secreting cells and visible by light microscopy. Contain zymogen, an inactive enzyme precursor, often of a digestive enzyme.

Chain B (RGS2_HUMAN | P41220)

molecular function
	GO:0001965	G-protein alpha-subunit binding	Interacting selectively and non-covalently with a G-protein alpha subunit. The alpha subunit binds a guanine nucleotide.
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0048487	beta-tubulin binding	Interacting selectively and non-covalently with the microtubule constituent protein beta-tubulin.
	GO:0005516	calmodulin binding	Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0050873	brown fat cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of a brown adipocyte, an animal connective tissue cell involved in adaptive thermogenesis. Brown adipocytes contain multiple small droplets of triglycerides and a high number of mitochondria.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0045744	negative regulation of G-protein coupled receptor protein signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of G-protein coupled receptor protein signaling pathway activity.
	GO:0043407	negative regulation of MAP kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of MAP kinase activity.
	GO:0043951	negative regulation of cAMP-mediated signaling	Any process which stops, prevents, or reduces the frequency, rate or extent of cAMP-mediated signaling, a series of molecular signals in which a cell uses cyclic AMP to convert an extracellular signal into a response.
	GO:0010614	negative regulation of cardiac muscle hypertrophy	Any process that decreases the rate, frequency or extent of the enlargement or overgrowth of all or part of the heart due to an increase in size (not length) of individual cardiac muscle fibers, without cell division.
	GO:0010519	negative regulation of phospholipase activity	Any process that decreases the frequency, rate or extent of phospholipase activity, the hydrolysis of a phospholipid.
	GO:0009968	negative regulation of signal transduction	Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0060452	positive regulation of cardiac muscle contraction	Any process that increases the frequency, rate or extent of cardiac muscle contraction.
	GO:0031116	positive regulation of microtubule polymerization	Any process that activates or increases the frequency, rate or extent of microtubule polymerization.
	GO:0008277	regulation of G-protein coupled receptor protein signaling pathway	Any process that modulates the frequency, rate or extent of G-protein coupled receptor protein signaling pathway activity.
	GO:0071877	regulation of adrenergic receptor signaling pathway	Any process that modulates the frequency, rate or extent of an adrenergic receptor signaling pathway activity. An adrenergic receptor signaling pathway is the series of molecular signals generated as a consequence of an adrenergic receptor binding to one of its physiological ligands.
	GO:0006417	regulation of translation	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
	GO:0055119	relaxation of cardiac muscle	The process in which the extent of cardiac muscle contraction is reduced.
	GO:0060087	relaxation of vascular smooth muscle	A negative regulation of smooth muscle contraction resulting in relaxation of vascular smooth muscle. The relaxation is mediated by a decrease in the phosphorylation state of myosin light chain. This can be achieved by removal of calcium from the cytoplasm to the sarcoplasmic reticulum lumen through the action of Ca2+ ATPases leading to a decrease myosin light chain kinase activity, and through calcium-independent pathways leading to a increase in myosin light chain phosphatase activity.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0009898	cytoplasmic side of plasma membrane	The leaflet the plasma membrane that faces the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ALF	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GDP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Glu A:116 - Gly A:117	[ RasMol ]
		Ser B:73 - Pro B:74	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2v4z
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GNAI3_HUMAN \| P08754
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	RGS2_HUMAN \| P41220
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	602483
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GNAI3_HUMAN \| P08754
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	RGS2_HUMAN \| P41220
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GNAI3_HUMAN \| P08754	:	2ihb 2ode 4g5o 4g5r 4g5s
	RGS2_HUMAN \| P41220	:	2af0 4ekc 4ekd

2af0	STRUCTURE OF THE REGULATOR OF G-PROTEIN SIGNALING DOMAIN OFRGS2
2ihb	CRYSTAL STRUCTURE OF THE HETERODIMERIC COMPLEX OF HUMANRGS10 AND ACTIVATED GI ALPHA 3

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (1, 1)

Exons (11, 11)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (2, 2)

Pfam Domains (0, 0)

Gene Ontology (64, 69)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File