2V4M - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   THE ISOMERASE DOMAIN OF HUMAN GLUTAMINE-FRUCTOSE-6-PHOSPHATE TRANSAMINASE 1 (GFPT1) IN COMPLEX WITH FRUCTOSE 6-PHOSPHATE

Authors :   M. Moche, L. Lehtio, J. Andersson, C. H. Arrowsmith, H. Berglund, R. Collins, L. G. Dahlgren, A. M. Edwards, S. Flodin, A. Flores, S. Graslund, M. Hammarstrom, A. Johansson, I. Johansson, T. Karlberg, T. Kotenyova, M. E. Nilsson, T. Nyman, C. Persson, J. Sagemark, S. Svensson, H. Schueler, A. G. Thorsell, L. Tresaugues, J. Uppenberg, S. Van Den Berg, M. Welin, M. Wisniewska, J. Weigelt, P. Nordlund, M. Wikstrom

Date :   26 Sep 08 (Deposition) - 07 Oct 08 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.29

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Phosphoprotein, Aminotransferase, Fructose 6-Phosphate, Alternative Splicing, Glutamine Amidotransferase, Dimer, Isomerase, Sis Domains, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Moche, L. Lehtio, J. Andersson, C. H. Arrowsmith, H. Berglund, R. Collins, L. G. Dahlgren, A. M. Edwards, S. Flodin, A. Flores, S. Graslund, M. Hammarstrom, A. Johansson, I. Johansson, T. Karlberg, T. Kotenyova, M. E. Nilsson, T. Nyman, C. Persson, J. Sagemark, S. Svensson, H. Schueler, A. G. Thorsell, L. Tresaugues, J. Uppenberg, S. Van Den Berg, M. Welin, M. Wisniewska, J. Weigelt, P. Nordlund, M. Wikstrom
The Isomerase Domain Of Human Gfpt1 In Complex With Fructose 6-Phosphate
To Be Published
PubMed: search

Molecule 1 - GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE AMINOTRANSFERASE [ISOMERIZING] 1
	Chains	:	A, B, C, D
	EC Number	:	2.6.1.16
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	EACH SUBUNIT HAS TWO SIS DOMAINS, RESIDUES 332-699
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ISOMERASE DOMAIN OF GLUTAMINE-FRUCTOSE-6- PHOSPHATE TRANSAMINASE 1, D-FRUCTOSE-6-PHOSPHATE AMIDOTRANSFERASE 1, HEXOSEPHOSPHATE AMINOTRANSFERASE 1, GFAT 1

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 5)

No.	Name	Count	Type	Full Name
1	CL	1	Ligand/Ion	CHLORIDE ION
2	F6R	4	Ligand/Ion	FRUCTOSE -6-PHOSPHATE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	F6R	2	Ligand/Ion	FRUCTOSE -6-PHOSPHATE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	F6R	2	Ligand/Ion	FRUCTOSE -6-PHOSPHATE

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	CYS A:392 , GLY A:393 , THR A:394 , SER A:395 , SER A:439 , GLN A:440 , SER A:441 , THR A:444 , ALA A:491 , SER A:492 , LYS A:576 , GLU A:579 , HOH A:2035 , HIS B:595	BINDING SITE FOR RESIDUE F6R A 800
2	AC2	SOFTWARE	HIS A:595 , CYS B:392 , GLY B:393 , THR B:394 , SER B:395 , SER B:439 , GLN B:440 , SER B:441 , THR B:444 , ALA B:491 , SER B:492 , LYS B:576 , GLU B:579 , HOH B:2011	BINDING SITE FOR RESIDUE F6R B 800
3	AC3	SOFTWARE	GLY C:393 , THR C:394 , SER C:395 , SER C:439 , GLN C:440 , SER C:441 , THR C:444 , ALA C:491 , SER C:492 , LYS C:576 , GLU C:579 , HOH C:2023 , HOH C:2050 , HIS D:595	BINDING SITE FOR RESIDUE F6R C 800
4	AC4	SOFTWARE	HIS C:595 , GLY D:393 , THR D:394 , SER D:395 , SER D:439 , GLN D:440 , SER D:441 , THR D:444 , ALA D:491 , SER D:492 , LYS D:576 , GLU D:579 , HOH D:2025 , HOH D:2065	BINDING SITE FOR RESIDUE F6R D 800
5	AC5	SOFTWARE	ARG C:361 , LEU C:371 , GLY C:372 , GLY C:373	BINDING SITE FOR RESIDUE CL C1691

(no "SS Bond" information available for 2V4M)

(no "Cis Peptide Bond" information available for 2V4M)

Asymmetric Unit (7, 28)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_065345	D	366	Y	GFPT1_HUMAN	Disease (CMS12)	---	A/B/C/D	D	366	Y
2	UniProt	VAR_065346	R	403	H	GFPT1_HUMAN	Disease (CMS12)	---	A/B/C/D	R	403	H
3	UniProt	VAR_065347	R	452	H	GFPT1_HUMAN	Disease (CMS12)	---	A/B/C/D	R	452	H
4	UniProt	VAR_065348	M	509	T	GFPT1_HUMAN	Disease (CMS12)	---	A/B/C/D	M	509	T
5	UniProt	VAR_065349	M	510	T	GFPT1_HUMAN	Disease (CMS12)	---	A/B/C/D	M	510	T
6	UniProt	VAR_065350	R	514	W	GFPT1_HUMAN	Disease (CMS12)	---	A/B/C/D	R	514	W
7	UniProt	VAR_065351	R	530	W	GFPT1_HUMAN	Disease (CMS12)	---	A/B/C/D	R	530	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (7, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_065345	D	366	Y	GFPT1_HUMAN	Disease (CMS12)	---	A/B	D	366	Y
2	UniProt	VAR_065346	R	403	H	GFPT1_HUMAN	Disease (CMS12)	---	A/B	R	403	H
3	UniProt	VAR_065347	R	452	H	GFPT1_HUMAN	Disease (CMS12)	---	A/B	R	452	H
4	UniProt	VAR_065348	M	509	T	GFPT1_HUMAN	Disease (CMS12)	---	A/B	M	509	T
5	UniProt	VAR_065349	M	510	T	GFPT1_HUMAN	Disease (CMS12)	---	A/B	M	510	T
6	UniProt	VAR_065350	R	514	W	GFPT1_HUMAN	Disease (CMS12)	---	A/B	R	514	W
7	UniProt	VAR_065351	R	530	W	GFPT1_HUMAN	Disease (CMS12)	---	A/B	R	530	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (7, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_065345	D	366	Y	GFPT1_HUMAN	Disease (CMS12)	---	C/D	D	366	Y
2	UniProt	VAR_065346	R	403	H	GFPT1_HUMAN	Disease (CMS12)	---	C/D	R	403	H
3	UniProt	VAR_065347	R	452	H	GFPT1_HUMAN	Disease (CMS12)	---	C/D	R	452	H
4	UniProt	VAR_065348	M	509	T	GFPT1_HUMAN	Disease (CMS12)	---	C/D	M	509	T
5	UniProt	VAR_065349	M	510	T	GFPT1_HUMAN	Disease (CMS12)	---	C/D	M	510	T
6	UniProt	VAR_065350	R	514	W	GFPT1_HUMAN	Disease (CMS12)	---	C/D	R	514	W
7	UniProt	VAR_065351	R	530	W	GFPT1_HUMAN	Disease (CMS12)	---	C/D	R	530	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SIS	PS51464	SIS domain profile.	GFPT1_HUMAN	377-516 548-689	8	A:377-516 B:377-516 C:377-516 D:377-516 A:548-687 B:548-687 C:548-689 D:548-687

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SIS	PS51464	SIS domain profile.	GFPT1_HUMAN	377-516 548-689	4	A:377-516 B:377-516 - - A:548-687 B:548-687 - -

Biological Unit 2 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SIS	PS51464	SIS domain profile.	GFPT1_HUMAN	377-516 548-689	4	- - C:377-516 D:377-516 - - C:548-689 D:548-687

(no "Exon" information available for 2V4M)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:352
 aligned with GFPT1_HUMAN | Q06210 from UniProtKB/Swiss-Prot  Length:699

    Alignment length:352
                                   345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635       645       655       665       675       685  
          GFPT1_HUMAN   336 KGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVD 687
               SCOP domains d2v4ma_ A: automated matches                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhh..ee....ee.hhhhh.hhhhhhh..eeeeeehhhhhhhhhhhhhhhhhhhh..eeeeehhhhhhh.......eeeeeee....hhhhhhhhhhhhhh..eeeeee....hhhhhhh.eeee...........hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhhhhhh.....eeeee....hhhhhhhhhhhhhh.....eeeee..hhhhhhh...eeee......hhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------Y------------------------------------H------------------------------------------------H--------------------------------------------------------TT---W---------------W------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------SIS  PDB: A:377-516 UniProt: 377-516                                                                                                        -------------------------------SIS  PDB: A:548-687 UniProt: 548-689                                                                                                         PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2v4m A 336 KGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVD 687
                                   345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635       645       655       665       675       685

Chain B from PDB  Type:PROTEIN  Length:351
 aligned with GFPT1_HUMAN | Q06210 from UniProtKB/Swiss-Prot  Length:699

    Alignment length:351
                                   346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686 
          GFPT1_HUMAN   337 GNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVD 687
               SCOP domains d2v4mb_ B: automated matches                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhh...ee....ee.hhhhh.hhhhhhh..eeeeeehhhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhh......eeeeeee....hhhhhhhhhhhhhh..eeeeee....hhhhhhh.eeee...........hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeee...hhhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhh.....eeeee....hhhhhhhhhhhhhh....eeeeee..hhhhhh....eeee......hhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -----------------------------Y------------------------------------H------------------------------------------------H--------------------------------------------------------TT---W---------------W------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------SIS  PDB: B:377-516 UniProt: 377-516                                                                                                        -------------------------------SIS  PDB: B:548-687 UniProt: 548-689                                                                                                         PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2v4m B 337 GNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVD 687
                                   346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686

Chain C from PDB  Type:PROTEIN  Length:352
 aligned with GFPT1_HUMAN | Q06210 from UniProtKB/Swiss-Prot  Length:699

    Alignment length:352
                                   348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688  
          GFPT1_HUMAN   339 FSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPR 690
               SCOP domains d2v4mc_ C: automated matches                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhh..ee....ee.hhhhh.hhhhhhh..eeeeeehhhhhhhhhhhhhhhhhhhh..eeeeehhhhhhh.......eeeeeee....hhhhhhhhhhhhhh..eeeeee....hhhhhhh.eeee...........hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhhhhhh.....eeeee....hhhhhhhhhhhhhhh....eeeee..hhhhhhhh..eeee......hhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------Y------------------------------------H------------------------------------------------H--------------------------------------------------------TT---W---------------W---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------SIS  PDB: C:377-516 UniProt: 377-516                                                                                                        -------------------------------SIS  PDB: C:548-689 UniProt: 548-689                                                                                                          - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2v4m C 339 FSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPR 690
                                   348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688

Chain D from PDB  Type:PROTEIN  Length:350
 aligned with GFPT1_HUMAN | Q06210 from UniProtKB/Swiss-Prot  Length:699

    Alignment length:350
                                   347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687
          GFPT1_HUMAN   338 NFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVD 687
               SCOP domains d2v4md_ D: automated matches                                                                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIS-2v4mD01 D:551-682                                                                                                               ----- Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIS-2v4mD02 D:551-682                                                                                                               ----- Pfam domains (2)
           Pfam domains (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIS-2v4mD03 D:551-682                                                                                                               ----- Pfam domains (3)
           Pfam domains (4) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIS-2v4mD04 D:551-682                                                                                                               ----- Pfam domains (4)
           Pfam domains (5) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIS-2v4mD05 D:551-682                                                                                                               ----- Pfam domains (5)
           Pfam domains (6) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIS-2v4mD06 D:551-682                                                                                                               ----- Pfam domains (6)
           Pfam domains (7) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIS-2v4mD07 D:551-682                                                                                                               ----- Pfam domains (7)
           Pfam domains (8) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SIS-2v4mD08 D:551-682                                                                                                               ----- Pfam domains (8)
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh..ee....ee.hhhhh.hhhhhh...eeeeeehhhhhhhhhhhhhhhhhhhh..eeeeehhhhhhh.......eeeeeee....hhhhhhhhhhhhhh..eeeeee....hhhhhhh.eeee...........hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeehhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhhhhhh.....eeeee....hhhhhhhhhhhhhhh....eeeee..hhhhhhhh..eeee......hhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------Y------------------------------------H------------------------------------------------H--------------------------------------------------------TT---W---------------W------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------SIS  PDB: D:377-516 UniProt: 377-516                                                                                                        -------------------------------SIS  PDB: D:548-687 UniProt: 548-689                                                                                                         PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2v4m D 338 NFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVD 687
                                   347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: SIS domain (85)

Superfamily: SIS domain (85)

Family: automated matches (22)

Protein domain: automated matches (22)

Human (Homo sapiens) [TaxId: 9606] (3)

1a	d2v4ma_	A:
1b	d2v4mb_	B:
1c	d2v4mc_	C:
1d	d2v4md_	D:

(no "CATH Domain" information available for 2V4M)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: SIS (53)

Family: SIS (23)

Homo sapiens (Human) (3)

1a	SIS-2v4mD01	D:551-682
1b	SIS-2v4mD02	D:551-682
1c	SIS-2v4mD03	D:551-682
1d	SIS-2v4mD04	D:551-682
1e	SIS-2v4mD05	D:551-682
1f	SIS-2v4mD06	D:551-682
1g	SIS-2v4mD07	D:551-682
1h	SIS-2v4mD08	D:551-682

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (GFPT1_HUMAN | Q06210)

molecular function
	GO:0016597	amino acid binding	Interacting selectively and non-covalently with an amino acid, organic acids containing one or more amino substituents.
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0004360	glutamine-fructose-6-phosphate transaminase (isomerizing) activity	Catalysis of the reaction: beta-D-fructose 6-phosphate + L-glutamine = D-glucosamine 6-phosphate + L-glutamate.
	GO:0008483	transaminase activity	Catalysis of the transfer of an amino group to an acceptor, usually a 2-oxo acid.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0036498	IRE1-mediated unfolded protein response	A series of molecular signals mediated by the endoplasmic reticulum stress sensor IRE1 (Inositol-requiring transmembrane kinase/endonuclease). Begins with activation of IRE1 in response to endoplasmic reticulum (ER) stress, and ends with regulation of a downstream cellular process, e.g. transcription. One target of activated IRE1 is the transcription factor HAC1 in yeast, or XBP1 in mammals; IRE1 cleaves an intron of a mRNA coding for HAC1/XBP1 to generate an activated HAC1/XBP1 transcription factor, which controls the up regulation of UPR-related genes. At least in mammals, IRE1 can also signal through additional intracellular pathways including JNK and NF-kappaB.
	GO:0006048	UDP-N-acetylglucosamine biosynthetic process	The chemical reactions and pathways resulting in the formation of UDP-N-acetylglucosamine, a substance composed of N-acetylglucosamine, a common structural unit of oligosaccharides, in glycosidic linkage with uridine diphosphate.
	GO:0006047	UDP-N-acetylglucosamine metabolic process	The chemical reactions and pathways involving UDP-N-acetylglucosamine, a substance composed of N-acetylglucosamine, a common structural unit of oligosaccharides, in glycosidic linkage with uridine diphosphate.
	GO:1901137	carbohydrate derivative biosynthetic process	The chemical reactions and pathways resulting in the formation of carbohydrate derivative.
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0032869	cellular response to insulin stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
	GO:0032922	circadian regulation of gene expression	Any process that modulates the frequency, rate or extent of gene expression such that an expression pattern recurs with a regularity of approximately 24 hours.
	GO:0006112	energy reserve metabolic process	The chemical reactions and pathways by which a cell derives energy from stored compounds such as fats or glycogen.
	GO:0006002	fructose 6-phosphate metabolic process	The chemical reactions and pathways involving fructose 6-phosphate, also known as F6P. The D-enantiomer is an important intermediate in glycolysis, gluconeogenesis, and fructose metabolism.
	GO:0006042	glucosamine biosynthetic process	The chemical reactions and pathways resulting in the formation of glucosamine (2-amino-2-deoxyglucopyranose), an aminodeoxysugar that occurs in combined form in chitin.
	GO:0006541	glutamine metabolic process	The chemical reactions and pathways involving glutamine, 2-amino-4-carbamoylbutanoic acid.
	GO:0045719	negative regulation of glycogen biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of glycogen.
	GO:0051289	protein homotetramerization	The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
	GO:0032868	response to insulin	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
	GO:0009744	response to sucrose	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a sucrose stimulus.
	GO:0048511	rhythmic process	Any process pertinent to the generation and maintenance of rhythms in the physiology of an organism.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		F6R	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2v4m)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2v4m
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GFPT1_HUMAN \| Q06210
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.6.1.16
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	610542
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GFPT1_HUMAN \| Q06210
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GFPT1_HUMAN \| Q06210	:	2zj3 2zj4

(no "Related Entries Specified in the PDB File" available for 2V4M)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 5)

Sites (5, 5)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (7, 28)

PROSITE Motifs (1, 8)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (1, 8)

Gene Ontology (23, 23)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File