Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF NASTURTIUM XYLOGLUCAN HYDROLASE ISOFORM NXG2
 
Authors :  M. J. Baumann, J. M. Eklof, G. Michel, A. Kallas, T. T. Teeri, H. Brumer, M. Czjzek
Date :  20 Mar 07  (Deposition) - 26 Jun 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Tropaeolum Majus, Xyloglucan Hydrolase, Xyloglucan-Endo- Transferase, Hydrolase, Glycosidase, Family Gh16, Isoform Nxg2 (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. J. Baumann, J. M. Eklof, G. Michel, A. M. Kallas, T. T. Teeri, M. Czjzek, H. Brumer
Structural Evidence For The Evolution Of Xyloglucanase Activity From Xyloglucan Endo- Transglycosylases: Biological Implications For Cell Wall Metabolism.
Plant Cell V. 19 1947 2007
PubMed-ID: 17557806  |  Reference-DOI: 10.1105/TPC.107.051391

(-) Compounds

Molecule 1 - CELLULASE
    ChainsA, B
    EC Number3.2.1.151, 3.2.1.4
    EngineeredYES
    Expression SystemPICHIA PASTORIS
    Expression System PlasmidPPIC9-NXG2
    Expression System Taxid4922
    Expression System VectorPGEM T EASY
    FragmentRESIDUES 25-295
    Organism CommonNASTURTIUM
    Organism ScientificTROPAEOLUM MAJUS
    Organism Taxid4020
    SynonymXYLOGLUCAN HYDROLASE
    TissueSEEDLING

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2UWC)

(-) Sites  (0, 0)

(no "Site" information available for 2UWC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2UWC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2UWC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2UWC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2UWC)

(-) Exons   (0, 0)

(no "Exon" information available for 2UWC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:266
 aligned with Q07524_TROMA | Q07524 from UniProtKB/TrEMBL  Length:295

    Alignment length:269
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286         
         Q07524_TROMA    27 PPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDSTSGSGFKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEGSGDYNIIGREMRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYGQLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC 295
               SCOP domains d2uwca_ A: automated matches                                                                                                                                                                                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhh...hhhh.eeeeehhh.eeee..eeeeee.....eeeeeeeeeeeeeeeeeee........eeeeeeee..........eeeeeee........eeeeeee.............eeee....................................hhhhh....eeeeeeeee......---....hhhhh.eeeeeeeeeeeeee............hhhhh.hhhhhhhhhhhhhhheeee.hhh...hhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2uwc A   3 PPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDSTSGSGFKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEGSGDYNIIGRELRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRPMWVYGSVWDASSWAT---KYKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYGQLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC 271
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192   |   202       212       222       232       242       252       262         
                                                                                                                                                                                                                       192 196                                                                           

Chain B from PDB  Type:PROTEIN  Length:265
 aligned with Q07524_TROMA | Q07524 from UniProtKB/TrEMBL  Length:295

    Alignment length:269
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286         
         Q07524_TROMA    27 PPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDSTSGSGFKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEGSGDYNIIGREMRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYGQLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC 295
               SCOP domains d2uwcb_ B: automated matches                                                                                                                                                                                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----------------Glyco_hydro_16-2uwcB01 B:19-203                                                                                                                                                          --------------XET_C-2uwcB03 B:218-271                                Pfam domains (1)
           Pfam domains (2) ----------------Glyco_hydro_16-2uwcB02 B:19-203                                                                                                                                                          --------------XET_C-2uwcB04 B:218-271                                Pfam domains (2)
         Sec.struct. author ......hhhhhh...hhhh.eeeeehhh.eeee..eeeeee.....eeeee...eeeeeeeeeee........eeeeeeee..........eeeeeee........eeeeeee.............eeee.........eeeeeee...eeeeee..eeeeeee..hhhhh.....eeeeeeee......----...hhhhh.eeeeeeeeeeeeee............hhhhh.hhhhhhhhhhhhhhheeee.hhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2uwc B   3 PPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDSTSGSGFKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEGSGDYNIIGRELRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRPMWVYGSVWDASSWAT----YKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYGQLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC 271
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192    |  202       212       222       232       242       252       262         
                                                                                                                                                                                                                       192  197                                                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2UWC)

(-) Pfam Domains  (2, 4)

Asymmetric Unit

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q07524_TROMA | Q07524)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0004553    hydrolase activity, hydrolyzing O-glycosyl compounds    Catalysis of the hydrolysis of any O-glycosyl bond.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016762    xyloglucan:xyloglucosyl transferase activity    Catalysis of the cleavage of a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0042546    cell wall biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of a cell wall. Includes biosynthesis of constituent macromolecules, such as proteins and polysaccharides, and those macromolecular modifications that are involved in synthesis or assembly of the cellular component. A cell wall is the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
    GO:0071555    cell wall organization    A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
    GO:0006073    cellular glucan metabolic process    The chemical reactions and pathways involving glucans, polysaccharides consisting only of glucose residues, occurring at the level of an individual cell.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0010411    xyloglucan metabolic process    The chemical reactions and pathways involving xyloglucan, the cross-linking glycan composed of (1->4)-beta-D-glucan backbone substituted at regular intervals with beta-D-xylosyl-(1->6) residues, which is present in the primary cell wall of most higher plants.
cellular component
    GO:0048046    apoplast    The cell membranes and intracellular regions in a plant are connected through plasmodesmata, and plants may be described as having two major compartments: the living symplast and the non-living apoplast. The apoplast is external to the plasma membrane and includes cell walls, intercellular spaces and the lumen of dead structures such as xylem vessels. Water and solutes pass freely through it.
    GO:0005618    cell wall    The rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal, most prokaryotic cells and some protozoan parasites, maintaining their shape and protecting them from osmotic lysis. In plants it is made of cellulose and, often, lignin; in fungi it is composed largely of polysaccharides; in bacteria it is composed of peptidoglycan; in protozoan parasites such as Giardia species, it's made of carbohydrates and proteins.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2uwc)
 
  Sites
(no "Sites" information available for 2uwc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2uwc)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2uwc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q07524_TROMA | Q07524
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.151
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  3.2.1.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q07524_TROMA | Q07524
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q07524_TROMA | Q075242uwa 2uwb 2vh9

(-) Related Entries Specified in the PDB File

2uwb CRYSTAL STRUCTURE OF THE NASTURTIUM SEEDLING MUTANT XYLOGLUCANASE ISOFORM NXG1-DELTA-YNIIG