Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF ZALPHA DOMAIN OF GOLDFISH ZBP-CONTAINING PROTEIN KINASE
 
Authors :  A. Lee, C. Park, J. Park, M. Kwon, Y. Choi, K. Kim, B. Choi, J. Lee
Date :  08 Jul 15  (Deposition) - 03 Feb 16  (Release) - 07 Jun 17  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
NMR Structure *:  A  (1x)
Keywords :  Z Dna Binding Protein, Helix Turn Helix, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. R. Lee, C. J. Park, H. K. Cheong, K. S. Ryu, J. W. Park, M. Y. Kwon, J. Lee K. K. Kim, B. S. Choi, J. H. Lee
Solution Structure Of The Z-Dna Binding Domain Of Pkr-Like Protein Kinase From Carassius Auratus And Quantitative Analyses Of The Intermediate Complex During B-Z Transition.
Nucleic Acids Res. V. 44 2936 2016
PubMed-ID: 26792893  |  Reference-DOI: 10.1093/NAR/GKW025

(-) Compounds

Molecule 1 - INTERFERON-INDUCIBLE AND DOUBLE-STRANDED-DEPENDENT EIF- 2KINASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorPET28A
    FragmentUNP RESIDUES 1-64
    Organism CommonGOLDFISH
    Organism ScientificCARASSIUS AURATUS
    Organism Taxid7957

 Structural Features

(-) Chains, Units

  1
NMR Structure (10x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2RVC)

(-) Sites  (0, 0)

(no "Site" information available for 2RVC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2RVC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2RVC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2RVC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2RVC)

(-) Exons   (0, 0)

(no "Exon" information available for 2RVC)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:64
                                                                                               
               SCOP domains ---------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhh..eeee.....eeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                  2rvc A  1 MSAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLME 64
                                    10        20        30        40        50        60    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2RVC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2RVC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2RVC)

(-) Gene Ontology  (17, 17)

NMR Structure(hide GO term definitions)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2rvc)
 
  Sites
(no "Sites" information available for 2rvc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2rvc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2rvc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7T2M9_CARAU | Q7T2M9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q7T2M9_CARAU | Q7T2M9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q7T2M9_CARAU | Q7T2M94kmf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2RVC)