Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF HUMAN PIN1 PPIASE MUTANT C113A
 
Authors :  W. Jing, N. Tochio, S. Tate
Date :  20 Jan 15  (Deposition) - 06 Jan 16  (Release) - 06 Jan 16  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
NMR Structure *:  A  (1x)
Keywords :  Cys-113 Mutation, Human Pin1 Ppiase, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Wang, N. Tochio, R. Kawasaki, Y. Tamari, N. Xu, J. Uewaki, N. Utsunomiya-Tate, S. Tate
Allosteric Breakage Of The Hydrogen Bond Within The Dual-Histidine Motif In The Active Site Of Human Pin1 Ppias
Biochemistry V. 54 5242 2015
PubMed-ID: 26226559  |  Reference-DOI: 10.1021/ACS.BIOCHEM.5B00606

(-) Compounds

Molecule 1 - PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
    ChainsA
    EC Number5.2.1.8
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorPET28A
    Expression System Vector TypeVECTOR
    FragmentUNP RESIDUES 51-163
    GenePIN1
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPEPTIDYL-PROLYL CIS-TRANS ISOMERASE PIN1, PPIASE PIN1, ROTAMASE PIN1

 Structural Features

(-) Chains, Units

  1
NMR Structure (10x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2RUQ)

(-) Sites  (0, 0)

(no "Site" information available for 2RUQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2RUQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2RUQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2RUQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2RUQ)

(-) Exons   (0, 0)

(no "Exon" information available for 2RUQ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:117
                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeeee..................hhhhhhhhhhhhhhhhhh...hhhhhhh....hhhhhh..eeeeee....hhhhhhhhh..........ee....eeeeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------- Transcript
                 2ruq A   1 GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 117
                                    10        20        30        40        50        60        70        80        90       100       110       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2RUQ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2RUQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2RUQ)

(-) Gene Ontology  (42, 42)

NMR Structure(hide GO term definitions)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ruq)
 
  Sites
(no "Sites" information available for 2ruq)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ruq)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ruq
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PIN1_HUMAN | Q13526
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.2.1.8
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PIN1_HUMAN | Q13526
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PIN1_HUMAN | Q135261f8a 1i6c 1i8g 1i8h 1nmv 1nmw 1pin 1zcn 2f21 2itk 2kbu 2kcf 2lb3 2m8i 2m8j 2m9e 2m9f 2m9i 2m9j 2n1o 2q5a 2ruc 2rud 2rur 2xp3 2xp4 2xp5 2xp6 2xp7 2xp8 2xp9 2xpa 2xpb 2zqs 2zqt 2zqu 2zqv 2zr4 2zr5 2zr6 3i6c 3ik8 3ikd 3ikg 3jyj 3kab 3kac 3kad 3kaf 3kag 3kah 3kai 3kce 3ntp 3odk 3oob 3tc5 3tcz 3tdb 3wh0 4gwt 4gwv 4qib 4tns 4tyo 4u84 4u85 4u86 5b3w 5b3x 5b3y 5b3z 5bmy 5uy9

(-) Related Entries Specified in the PDB File

2rur