2RMX - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE SHP-1 C-TERMINAL SH2 DOMAIN COMPLEXED WITH A TYROSINE-PHOSPHORYLATED PEPTIDE FROM NKG2A

Authors :   T. Kasai, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   30 Nov 07 (Deposition) - 02 Dec 08 (Release) - 02 Dec 08 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (20x)

Keywords :   Sh2 Domain, Protein-Peptide Complex, Phosphorylated Peptide Recognition, Phosphotyrosine Binding Domain, Signal Transduction, Alternative Splicing, Cytoplasm, Hydrolase, Nucleus, Phosphoprotein, Protein Phosphatase, Glycoprotein, Lectin, Membrane, Receptor, Signal-Anchor, Transmembrane, Signaling Protein, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Koshiba, T. Kasai, M. Sato, T. Tomizawa, Y. Motoda, N. Tochio, N. Kobayashi, T. Harada, M. Inoue, A. Tanaka, T. Kigawa, S. Yokoyama
Structural Basis For The Recognition Of The Two Nkg2A Immunoreceptor Tyrosine-Based Inhibitory Motifs (Itims) By The C-Terminal Sh2 Domain Of Protein Tyrosine Phosphatase Shp-1
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE 6
	Chains	:	A
	EC Number	:	3.1.3.48
	Engineered	:	YES
	Expression System	:	CELL-FREE SYNTHESIS
	Expression System Vector	:	P040607-04
	Expression System Vector Type	:	VECTOR
	Fragment	:	SH2 DOMAIN
	Gene	:	PTPN6, HCP, PTP1C
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	E. COLI CELL-FREE
	Synonym	:	PROTEIN-TYROSINE PHOSPHATASE 1C, PTP-1C, HEMATOPOIETIC CELL PROTEIN-TYROSINE PHOSPHATASE, SH-PTP1, PROTEIN-TYROSINE PHOSPHATASE SHP-1

Molecule 2 - NKG2-A/NKG2-B TYPE II INTEGRAL MEMBRANE PROTEIN
	Chains	:	B
	Engineered	:	YES
	Fragment	:	TYROSINE PHOSPHORYLATION SITE, UNP RESIDUES 1-15
	Other Details	:	PEPTIDE SYNTHETIC; THIS SEQUENCE OCCURS NATURALLY IN HUMANS
	Synonym	:	NKG2-A/B-ACTIVATING NK RECEPTOR, NK CELL RECEPTOR A, CD159A ANTIGEN
	Synthetic	:	YES


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

NMR Structure (1, 1)

No.	Name	Count	Type	Full Name
1	PTR	1	Mod. Amino Acid	O-PHOSPHOTYROSINE

(no "Site" information available for 2RMX)

(no "SS Bond" information available for 2RMX)

(no "Cis Peptide Bond" information available for 2RMX)

(no "SAP(SNP)/Variant" information available for 2RMX)

NMR Structure (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH2	PS50001	Src homology 2 (SH2) domain profile.	PTN6_HUMAN	4-100 110-213	1	- A:8-111
2	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTN6_HUMAN	244-515	1	A:114-118

NMR Structure (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3	ENST00000318974	3	ENSE00001164365	chr12:7060434-7060683	250	PTN6_HUMAN	1-3	3	0	-	-
1.4	ENST00000318974	4	ENSE00000866991	chr12:7060772-7060894	123	PTN6_HUMAN	3-44	42	0	-	-
1.5	ENST00000318974	5	ENSE00000716206	chr12:7061146-7061340	195	PTN6_HUMAN	44-109	66	1	A:1-7 (gaps)	55
1.6	ENST00000318974	6	ENSE00000716209	chr12:7063968-7064157	190	PTN6_HUMAN	109-172	64	1	A:7-70	64
1.7	ENST00000318974	7	ENSE00000716212	chr12:7064314-7064430	117	PTN6_HUMAN	173-211	39	1	A:71-109	39
1.8	ENST00000318974	8	ENSE00000716214	chr12:7064535-7064648	114	PTN6_HUMAN	212-249	38	1	A:110-113	4
1.9	ENST00000318974	9	ENSE00000716216	chr12:7064823-7064919	97	PTN6_HUMAN	250-282	33	0	-	-
1.10	ENST00000318974	10	ENSE00000716218	chr12:7065305-7065384	80	PTN6_HUMAN	282-308	27	0	-	-
1.11	ENST00000318974	11	ENSE00000716220	chr12:7065582-7065731	150	PTN6_HUMAN	309-358	50	1	A:114-118 (gaps)	14
1.12	ENST00000318974	12	ENSE00000716222	chr12:7066817-7066948	132	PTN6_HUMAN	359-402	44	0	-	-
1.13	ENST00000318974	13	ENSE00000716225	chr12:7067082-7067236	155	PTN6_HUMAN	403-454	52	0	-	-
1.14	ENST00000318974	14	ENSE00000716227	chr12:7069090-7069157	68	PTN6_HUMAN	454-477	24	0	-	-
1.15	ENST00000318974	15	ENSE00000716229	chr12:7069251-7069402	152	PTN6_HUMAN	477-527	51	0	-	-
1.16	ENST00000318974	16	ENSE00000716231	chr12:7069507-7069598	92	PTN6_HUMAN	528-558	31	0	-	-
1.17c	ENST00000318974	17c	ENSE00001358823	chr12:7069969-7070108	140	PTN6_HUMAN	558-595	38	0	-	-
1.18	ENST00000318974	18	ENSE00001365384	chr12:7070289-7070479	191	PTN6_HUMAN	-	0	0	-	-

2.1	ENST00000359151	1	ENSE00000993571	chr12:10605947-10605797	151	NKG2A_HUMAN	-	0	0	-	-
2.2	ENST00000359151	2	ENSE00001337677	chr12:10603786-10603569	218	NKG2A_HUMAN	1-63	63	1	B:1-15	15
2.3	ENST00000359151	3	ENSE00000915517	chr12:10603178-10603083	96	NKG2A_HUMAN	63-95	33	0	-	-
2.4	ENST00000359151	4	ENSE00000915516	chr12:10602566-10602513	54	NKG2A_HUMAN	95-113	19	0	-	-
2.6	ENST00000359151	6	ENSE00001657718	chr12:10601987-10601836	152	NKG2A_HUMAN	113-163	51	0	-	-
2.7	ENST00000359151	7	ENSE00001633944	chr12:10600231-10600131	101	NKG2A_HUMAN	164-197	34	0	-	-
2.8	ENST00000359151	8	ENSE00001490174	chr12:10599261-10598642	620	NKG2A_HUMAN	197-233	37	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:118
 aligned with PTN6_HUMAN | P29350 from UniProtKB/Swiss-Prot  Length:595

    Alignment length:272
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324  
           PTN6_HUMAN    55 QNSGDFYDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIASQG 326
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2rmx                                                A00 A:1-118 SHC Adaptor Protein                                                                                                                                                                                              CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....------------------------------------------------....eeee.hhhhhhhhhhhhh...eeeeee.......eeeeee.............eeeeeeeee..eee........hhhhhhhhhhhh.eee...eee........-------------------------------------------------------------------------------------------------..---------... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE SH2  PDB: - UniProt: 4-100                    ---------SH2  PDB: A:8-111 UniProt: 110-213                                                                      ------------------------------TYR_PHOSPHATASE_PTP  PDB: A:114-118 UniProt: 244-515                                PROSITE
           Transcript 1 (1) Exon 1.5  PDB: A:1-7 (gaps) UniProt: 44-109            ---------------------------------------------------------------Exon 1.7  PDB: A:71-109                Exon 1.8  PDB: A:110-113 [INCOMPLETE] --------------------------------Exon 1.10  PDB: -          Exon 1.11          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------Exon 1.6  PDB: A:7-70 UniProt: 109-172                          -----------------------------------------------------------------------------Exon 1.9  PDB: - UniProt: 250-282-------------------------------------------- Transcript 1 (2)
                 2rmx A   1 GSSG------------------------------------------------SSGWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYS-------------------------------------------------------------------------------------------------GP---------SSG 118
                               |     -         -         -         -         -  |     12        22        32        42        52        62        72        82        92       102       112|        -         -         -         -         -         -         -         -         -       115       116  
                               4                                                5                                                                                                         113                                                                                               114|       116  
                                                                                                                                                                                                                                                                                             115

Chain B from PDB  Type:PROTEIN  Length:15
 aligned with NKG2A_HUMAN | P26715 from UniProtKB/Swiss-Prot  Length:233

    Alignment length:15
                                    10     
          NKG2A_HUMAN     1 MDNQGVIYSDLNLPP  15
               SCOP domains --------------- SCOP domains
               CATH domains --------------- CATH domains
               Pfam domains --------------- Pfam domains
         Sec.struct. author ............... Sec.struct. author
                 SAPs(SNPs) --------------- SAPs(SNPs)
                    PROSITE --------------- PROSITE
               Transcript 2 Exon 2.2        Transcript 2
                 2rmx B   1 MDNQGVIySDLNLPP  15
                                   |10     
                                   8-PTR

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2RMX)

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: SHC Adaptor Protein (206)

Homologous Superfamily: SHC Adaptor Protein (206)

Human (Homo sapiens) (147)

2rmxA00

A:1-118

(no "Pfam Domain" information available for 2RMX)

NMR Structure(hide GO term definitions)

Chain A (PTN6_HUMAN | P29350)

molecular function
	GO:0042169	SH2 domain binding	Interacting selectively and non-covalently with a SH2 domain (Src homology 2) of a protein, a protein domain of about 100 amino-acid residues and belonging to the alpha + beta domain class.
	GO:0017124	SH3 domain binding	Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0001784	phosphotyrosine residue binding	Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0005001	transmembrane receptor protein tyrosine phosphatase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0050853	B cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0033277	abortive mitotic cell cycle	A cell cycle in which mitosis is begun and progresses normally through the end of anaphase, but not completed, resulting in a cell with increased ploidy.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0002244	hematopoietic progenitor cell differentiation	The process in which precursor cell type acquires the specialized features of a hematopoietic progenitor cell, a class of cell types including myeloid progenitor cells and lymphoid progenitor cells.
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0035855	megakaryocyte development	The process whose specific outcome is the progression of a megakaryocyte cell over time, from its formation to the mature structure. Megakaryocyte development does not include the steps involved in committing a cell to a megakaryocyte fate. A megakaryocyte is a giant cell 50 to 100 micron in diameter, with a greatly lobulated nucleus, found in the bone marrow.
	GO:0042267	natural killer cell mediated cytotoxicity	The directed killing of a target cell by a natural killer cell through the release of granules containing cytotoxic mediators or through the engagement of death receptors.
	GO:0050859	negative regulation of B cell receptor signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of signaling pathways initiated by the cross-linking of an antigen receptor on a B cell.
	GO:0043407	negative regulation of MAP kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of MAP kinase activity.
	GO:0043409	negative regulation of MAPK cascade	Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction mediated by the MAPKKK cascade.
	GO:0042130	negative regulation of T cell proliferation	Any process that stops, prevents or reduces the rate or extent of T cell proliferation.
	GO:0050860	negative regulation of T cell receptor signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of signaling pathways initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0002924	negative regulation of humoral immune response mediated by circulating immunoglobulin	Any process that stops, prevents, or reduces the frequency, rate, or extent of a humoral immune response mediated by circulating immunoglobulin.
	GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0018108	peptidyl-tyrosine phosphorylation	The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0030220	platelet formation	The process in which platelets bud from long processes extended by megakaryocytes.
	GO:0033630	positive regulation of cell adhesion mediated by integrin	Any process that activates or increases the frequency, rate, or extent of cell adhesion mediated by integrin.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0045577	regulation of B cell differentiation	Any process that modulates the frequency, rate or extent of B cell differentiation.
	GO:0070372	regulation of ERK1 and ERK2 cascade	Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:2000045	regulation of G1/S transition of mitotic cell cycle	Any cell cycle regulatory process that controls the commitment of a cell from G1 to S phase of the mitotic cell cycle.
	GO:0051279	regulation of release of sequestered calcium ion into cytosol	Any process that modulates the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria.
	GO:0060338	regulation of type I interferon-mediated signaling pathway	Any process that modulates the rate, frequency or extent of a type I interferon-mediated signaling pathway. A type I interferon-mediated signaling pathway is the series of molecular events generated as a consequence of a type I interferon binding to a cell surface receptor.
cellular component
	GO:0042105	alpha-beta T cell receptor complex	A T cell receptor complex in which the TCR heterodimer comprises alpha and beta chains, associated with the CD3 complex; recognizes a complex consisting of an antigen-derived peptide bound to a class I or class II MHC protein.
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (NKG2A_HUMAN | P26715)

molecular function
	GO:0023024	MHC class I protein complex binding	Interacting selectively and non-covalently with the class I major histocompatibility complex.
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:1990405	protein antigen binding	Interacting selectively and non-covalently with a protein antigen.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004888	transmembrane signaling receptor activity	Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0050776	regulation of immune response	Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		PTR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 2rmx)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2rmx)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2rmx
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NKG2A_HUMAN \| P26715
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PTN6_HUMAN \| P29350
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NKG2A_HUMAN \| P26715
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PTN6_HUMAN \| P29350
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 2RMX)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (6, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (63, 65)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File