|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (2, 16) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2RK2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2RK2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2RK2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2RK2) |
Exons (0, 0)| (no "Exon" information available for 2RK2) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:58 aligned with DYR21_ECOLX | P00383 from UniProtKB/Swiss-Prot Length:78 Alignment length:58 30 40 50 60 70 DYR21_ECOLX 21 NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN 78 SCOP domains d2rk2a_ A: automated matches SCOP domains CATH domains 2rk2A00 A:21-78 [code=2.30.30.60, no name defined] CATH domains Pfam domains DHFR_2-2rk2A01 A:21-78 Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 2rk2 A 21 NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN 78 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (8, 8)|
Asymmetric Unit(hide GO term definitions) Chain A (DYR21_ECOLX | P00383)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|