|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 19)
Asymmetric Unit (1, 19)
|
Sites (0, 0)| (no "Site" information available for 2RA2) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2RA2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2RA2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2RA2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2RA2) |
Exons (0, 0)| (no "Exon" information available for 2RA2) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:55 aligned with Q7CPV8_SALTY | Q7CPV8 from UniProtKB/TrEMBL Length:75 Alignment length:55 75 32 42 52 62 72 | Q7CPV8_SALTY 23 PNYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVALEN-- - SCOP domains d2ra2a1 A:4-56 Uncharacterized protein YgdI -- SCOP domains CATH domains 2ra2A00 A:4-58 [code=2.30.30.100, no name defined] CATH domains Pfam domains ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------- PROSITE Transcript ------------------------------------------------------- Transcript 2ra2 A 4 PNYVmHTNDGRSIVTDGKPQTDNDTGmISYKDANGNKQQINRTDVKEmVALENLE 58 | 13 23 | 33 43 |53 | 30-MSE 51-MSE 8-MSE Chain B from PDB Type:PROTEIN Length:59 aligned with Q7CPV8_SALTY | Q7CPV8 from UniProtKB/TrEMBL Length:75 Alignment length:59 75 29 39 49 59 69 | Q7CPV8_SALTY 20 CSGPNYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVALEN--- - SCOP domains d2ra2b_ B: Uncharacterized protein YgdI SCOP domains CATH domains -2ra2B00 B:2-59 [code=2.30.30.100, no name defined] CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------- Transcript 2ra2 B 1 mSGPNYVmHTNDGRSIVTDGKPQTDNDTGmISYKDANGNKQQINRTDVKEmVALENLEH 59 | |10 20 30 40 50| 1-MSE 8-MSE 30-MSE 51-MSE Chain C from PDB Type:PROTEIN Length:55 aligned with Q7CPV8_SALTY | Q7CPV8 from UniProtKB/TrEMBL Length:75 Alignment length:55 75 31 41 51 61 71 | Q7CPV8_SALTY 22 GPNYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVALEN- - SCOP domains d2ra2c_ C: Uncharacterized protein YgdI SCOP domains CATH domains 2ra2C00 C:3-57 [code=2.30.30.100, no name defined] CATH domains Pfam domains ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------- PROSITE Transcript ------------------------------------------------------- Transcript 2ra2 C 3 GPNYVmHTNDGRSIVTDGKPQTDNDTGmISYKDANGNKQQINRTDVKEmVALENL 57 | 12 22 |32 42 52 8-MSE 30-MSE 51-MSE Chain D from PDB Type:PROTEIN Length:55 aligned with Q7CPV8_SALTY | Q7CPV8 from UniProtKB/TrEMBL Length:75 Alignment length:55 30 40 50 60 70 Q7CPV8_SALTY 21 SGPNYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVALEN 75 SCOP domains d2ra2d_ D: Uncharacterized protein YgdI SCOP domains CATH domains 2ra2D00 D:2-56 [code=2.30.30.100, no name defined] CATH domains Pfam domains ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------- PROSITE Transcript ------------------------------------------------------- Transcript 2ra2 D 2 SGPNYVmHTNDGRSIVTDGKPQTDNDTGmISYKDANGNKQQINRTDVKEmVALEN 56 | 11 21 31 41 51 8-MSE 30-MSE 51-MSE Chain E from PDB Type:PROTEIN Length:53 aligned with Q7CPV8_SALTY | Q7CPV8 from UniProtKB/TrEMBL Length:75 Alignment length:53 32 42 52 62 72 Q7CPV8_SALTY 23 PNYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVALEN 75 SCOP domains d2ra2e_ E: Uncharacterized protein YgdI SCOP domains CATH domains 2ra2E00 E:4-56 [code=2.30.30.100, no name defined] CATH domains Pfam domains ----------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------- PROSITE Transcript ----------------------------------------------------- Transcript 2ra2 E 4 PNYVmHTNDGRSIVTDGKPQTDNDTGmISYKDANGNKQQINRTDVKEmVALEN 56 | 13 23 | 33 43 |53 8-MSE 30-MSE 51-MSE Chain F from PDB Type:PROTEIN Length:53 aligned with Q7CPV8_SALTY | Q7CPV8 from UniProtKB/TrEMBL Length:75 Alignment length:53 31 41 51 61 71 Q7CPV8_SALTY 22 GPNYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVALE 74 SCOP domains d2ra2f_ F: Uncharacterized protein YgdI SCOP domains CATH domains 2ra2F00 F:3-55 [code=2.30.30.100, no name defined] CATH domains Pfam domains (1) --DUF903-2ra2F01 F:5-54 - Pfam domains (1) Pfam domains (2) --DUF903-2ra2F02 F:5-54 - Pfam domains (2) Pfam domains (3) --DUF903-2ra2F03 F:5-54 - Pfam domains (3) Pfam domains (4) --DUF903-2ra2F04 F:5-54 - Pfam domains (4) Pfam domains (5) --DUF903-2ra2F05 F:5-54 - Pfam domains (5) Pfam domains (6) --DUF903-2ra2F06 F:5-54 - Pfam domains (6) SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------- PROSITE Transcript ----------------------------------------------------- Transcript 2ra2 F 3 GPNYVmHTNDGRSIVTDGKPQTDNDTGmISYKDANGNKQQINRTDVKEmVALE 55 | 12 22 |32 42 52 8-MSE 30-MSE 51-MSE
|
||||||||||||||||||||
SCOP Domains (1, 6)| Asymmetric Unit |
CATH Domains (1, 6)| Asymmetric Unit |
Pfam Domains (1, 6)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2RA2)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|