2QEP - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE D1 DOMAIN OF PTPRN2 (IA2BETA)

Authors :   E. Ugochukwu, A. Barr, I. Alfano, G. Berridge, N. Burgess-Brown, S. Das O. Fedorov, O. King, F. Niesen, S. Watt, P. Savitsky, E. Salah, A. C. W. P G. Bunkoczi, F. Von Delft, M. Sundstrom, A. Edwards, C. H. Arrowsmith J. Weigelt, S. Knapp, Structural Genomics Consortium (Sgc)

Date :   26 Jun 07 (Deposition) - 24 Jul 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Ptprn2, Ptprp, Phogrin, Ia-2 Beta, Autoantigen, Structural Genomics, Structural Genomics Consortium, Sgc, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. J. Barr, E. Ugochukwu, W. H. Lee, O. N. King, P. Filippakopoulos, I. Alfano, P. Savitsky, N. A. Burgess-Brown, S. Muller, S. Knapp
Large-Scale Structural Analysis Of The Classical Human Protein Tyrosine Phosphatome.
Cell(Cambridge, Mass. ) V. 136 352 2009
PubMed-ID: 19167335 | Reference-DOI: 10.1016/J.CELL.2008.11.038

Molecule 1 - RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE N2
	Chains	:	A, B
	EC Number	:	3.1.3.48
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PNIC-CH
	Expression System Strain	:	PHAGE-RESISTANT DERIVATIVE OF BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	D1 DOMAIN
	Gene	:	PTPRN2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	R-PTP-N2, ISLET CELL AUTOANTIGEN-RELATED PROTEIN, ICAAR, IAR, PHOGRIN

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 1)

No.	Name	Count	Type	Full Name
1	CL	1	Ligand/Ion	CHLORIDE ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION

(no "Site" information available for 2QEP)

(no "SS Bond" information available for 2QEP)

Asymmetric Unit

No.	Residues
1	Glu A:758	-	Pro A:759
2	Arg A:935	-	Gly A:936
3	Glu B:758	-	Pro B:759

(no "SAP(SNP)/Variant" information available for 2QEP)

Asymmetric Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTPR2_HUMAN	745-1005	2	A:745-1005 B:745-1005
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	PTPR2_HUMAN	924-996	2	A:924-996 B:924-996
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	PTPR2_HUMAN	943-953	2	A:943-953 B:943-953

Biological Unit 1 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTPR2_HUMAN	745-1005	1	A:745-1005 -
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	PTPR2_HUMAN	924-996	1	A:924-996 -
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	PTPR2_HUMAN	943-953	1	A:943-953 -

Biological Unit 2 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTPR2_HUMAN	745-1005	1	- B:745-1005
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	PTPR2_HUMAN	924-996	1	- B:924-996
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	PTPR2_HUMAN	943-953	1	- B:943-953

Asymmetric Unit (10, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1d	ENST00000389418	1d	ENSE00001952569	chr7:158380371-158380250	122	PTPR2_HUMAN	1-38	38	0	-	-
1.3	ENST00000389418	3	ENSE00001289898	chr7:158282477-158282427	51	PTPR2_HUMAN	38-55	18	0	-	-
1.4	ENST00000389418	4	ENSE00001302919	chr7:158109624-158109511	114	PTPR2_HUMAN	55-93	39	0	-	-
1.5	ENST00000389418	5	ENSE00001320738	chr7:157997965-157997863	103	PTPR2_HUMAN	93-127	35	0	-	-
1.6	ENST00000389418	6	ENSE00001301678	chr7:157985187-157985019	169	PTPR2_HUMAN	127-183	57	0	-	-
1.7	ENST00000389418	7	ENSE00001330207	chr7:157959983-157959623	361	PTPR2_HUMAN	184-304	121	0	-	-
1.8	ENST00000389418	8	ENSE00001147335	chr7:157931207-157930986	222	PTPR2_HUMAN	304-378	75	0	-	-
1.9	ENST00000389418	9	ENSE00001147328	chr7:157929387-157929347	41	PTPR2_HUMAN	378-391	14	0	-	-
1.10	ENST00000389418	10	ENSE00001147319	chr7:157926751-157926369	383	PTPR2_HUMAN	392-519	128	0	-	-
1.11	ENST00000389418	11	ENSE00001304923	chr7:157903607-157903521	87	PTPR2_HUMAN	519-548	30	0	-	-
1.12	ENST00000389418	12	ENSE00001319507	chr7:157874069-157873990	80	PTPR2_HUMAN	548-575	28	0	-	-
1.13	ENST00000389418	13	ENSE00001295610	chr7:157691429-157691365	65	PTPR2_HUMAN	575-596	22	0	-	-
1.14	ENST00000389418	14	ENSE00001302375	chr7:157475629-157475417	213	PTPR2_HUMAN	597-667	71	0	-	-
1.16	ENST00000389418	16	ENSE00001325204	chr7:157449243-157449049	195	PTPR2_HUMAN	668-732	65	2	A:724-732 B:724-732	9 9
1.17	ENST00000389418	17	ENSE00001315560	chr7:157414201-157414054	148	PTPR2_HUMAN	733-782	50	2	A:733-782 B:733-782	50 50
1.18	ENST00000389418	18	ENSE00001322732	chr7:157396767-157396694	74	PTPR2_HUMAN	782-806	25	2	A:782-806 B:782-806	25 25
1.19	ENST00000389418	19	ENSE00001324758	chr7:157388007-157387930	78	PTPR2_HUMAN	807-832	26	2	A:807-832 B:807-832 (gaps)	26 26
1.20	ENST00000389418	20	ENSE00001325921	chr7:157370832-157370713	120	PTPR2_HUMAN	833-872	40	2	A:833-872 B:833-872	40 40
1.21	ENST00000389418	21	ENSE00001292175	chr7:157369471-157369305	167	PTPR2_HUMAN	873-928	56	2	A:873-928 B:873-928	56 56
1.22	ENST00000389418	22	ENSE00001505822	chr7:157364185-157364132	54	PTPR2_HUMAN	928-946	19	2	A:928-946 B:928-946	19 19
1.23	ENST00000389418	23	ENSE00001290913	chr7:157361658-157361594	65	PTPR2_HUMAN	946-968	23	2	A:946-968 B:946-968	23 23
1.24	ENST00000389418	24	ENSE00001316950	chr7:157341713-157341640	74	PTPR2_HUMAN	968-992	25	2	A:968-992 (gaps) B:968-992 (gaps)	25 25
1.25b	ENST00000389418	25b	ENSE00001868942	chr7:157333479-157331760	1720	PTPR2_HUMAN	993-1015	23	2	A:993-1012 B:993-1012	20 20

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:288
 aligned with PTPR2_HUMAN | Q92932 from UniProtKB/Swiss-Prot  Length:1015

    Alignment length:289
                                   733       743       753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963       973       983       993      1003         
         PTPR2_HUMAN    724 DISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKA 1012
               SCOP domains d2qepa_ A: automated matches                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 2qepA00 A:724-1012 Protein tyrosine phosphatase superfamily                                                                                                                                                                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..............hhhhh.......hhhhh................eeee.........eeee...hhhhhhhhhhhhhhh...eeee....ee..ee..........eeee..eeeeeeeeeeee..eeeeeeeeee....eeeeeeeeee..........hhhhhhhhhhhhhhhhh.....eeee....hhhhhhhhhhhhhhhhhhh.-...hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------------TYR_PHOSPHATASE_PTP  PDB: A:745-1005 UniProt: 745-1005                                                                                                                                                                                                               ------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: A:924-996 UniProt: 924-996                       ---------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) Exon 1.16Exon 1.17  PDB: A:733-782 UniProt: 733-782        ------------------------Exon 1.19  PDB: A:807-832 Exon 1.20  PDB: A:833-872               Exon 1.21  PDB: A:873-928 UniProt: 873-928              -----------------Exon 1.23              ------------------------Exon 1.25b           Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.18  PDB: A:782-806-------------------------------------------------------------------------------------------------------------------------Exon 1.22          ---------------------Exon 1.24                -------------------- Transcript 1 (2)
                2qep A  724 DISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKG-KEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILAH 1012
                                   733       743       753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963    | |973       983       993      1003         
                                                                                                                                                                                                                                                                              968 |                                          
                                                                                                                                                                                                                                                                                970

Chain B from PDB  Type:PROTEIN  Length:287
 aligned with PTPR2_HUMAN | Q92932 from UniProtKB/Swiss-Prot  Length:1015

    Alignment length:289
                                   733       743       753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963       973       983       993      1003         
         PTPR2_HUMAN    724 DISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKA 1012
               SCOP domains d2qepb_ B: automated matches                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 2qepB00 B:724-1012 Protein tyrosine phosphatase superfamily                                                                                                                                                                                                                                       CATH domains
           Pfam domains (1) ----------------------------------------------Y_phosphatase-2qepB01 B:770-1004                                                                                                                                                                                                           -------- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------Y_phosphatase-2qepB02 B:770-1004                                                                                                                                                                                                           -------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...........hhhhhhhh...............hhhhh........eeee..-......eeee...hhhhhhhhhhhhhhhh..eeee....ee..ee..........eeee..eeeeeeeeeeee..eeeeeeeeee.....eeeeeeeee..........hhhhhhhhhhhhhhhhh.....eeee....hhhhhhhhhhhhhhhh....-...hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------------TYR_PHOSPHATASE_PTP  PDB: B:745-1005 UniProt: 745-1005                                                                                                                                                                                                               ------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: B:924-996 UniProt: 924-996                       ---------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) Exon 1.16Exon 1.17  PDB: B:733-782 UniProt: 733-782        ------------------------Exon 1.19 UniProt: 807-832Exon 1.20  PDB: B:833-872               Exon 1.21  PDB: B:873-928 UniProt: 873-928              -----------------Exon 1.23              ------------------------Exon 1.25b           Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.18  PDB: B:782-806-------------------------------------------------------------------------------------------------------------------------Exon 1.22          ---------------------Exon 1.24                -------------------- Transcript 1 (2)
                2qep B  724 DISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMD-DPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKG-KEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILAH 1012
                                   733       743       753       763       773       783       793       803    | |813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963    | |973       983       993      1003         
                                                                                                              808 |                                                                                                                                                           968 |                                          
                                                                                                                810                                                                                                                                                             970

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: (Phosphotyrosine protein) phosphatases II (296)

Superfamily: (Phosphotyrosine protein) phosphatases II (296)

Family: automated matches (83)

Protein domain: automated matches (83)

Human (Homo sapiens) [TaxId: 9606] (76)

1a	d2qepa_	A:
1b	d2qepb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Protein-Tyrosine Phosphatase; Chain A (262)

Homologous Superfamily: Protein tyrosine phosphatase superfamily (228)

Human (Homo sapiens) (196)

1a	2qepB00	B:724-1012
1b	2qepA00	A:724-1012

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Phosphatase (121)

Family: Y_phosphatase (93)

Homo sapiens (Human) (82)

1a	Y_phosphatase-2qepB01	B:770-1004
1b	Y_phosphatase-2qepB02	B:770-1004

Asymmetric Unit(hide GO term definitions)

Chain A,B (PTPR2_HUMAN | Q92932)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0005001	transmembrane receptor protein tyrosine phosphatase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0035773	insulin secretion involved in cellular response to glucose stimulus	The regulated release of proinsulin from secretory granules (B granules) in the B cells of the pancreas; accompanied by cleavage of proinsulin to form mature insulin, in response to a glucose stimulus.
	GO:0034260	negative regulation of GTPase activity	Any process that stops or reduces the rate of GTP hydrolysis by a GTPase.
	GO:0007269	neurotransmitter secretion	The regulated release of neurotransmitter from the presynapse into the synaptic cleft via calcium regualated exocytosis during synaptic transmission.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
cellular component
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0031410	cytoplasmic vesicle	A vesicle found in the cytoplasm of a cell.
	GO:0005788	endoplasmic reticulum lumen	The volume enclosed by the membranes of the endoplasmic reticulum.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0030141	secretory granule	A small subcellular vesicle, surrounded by a membrane, that is formed from the Golgi apparatus and contains a highly concentrated protein destined for secretion. Secretory granules move towards the periphery of the cell and upon stimulation, their membranes fuse with the cell membrane, and their protein load is exteriorized. Processing of the contained protein may take place in secretory granules.
	GO:0030667	secretory granule membrane	The lipid bilayer surrounding a secretory granule.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.
	GO:0030672	synaptic vesicle membrane	The lipid bilayer surrounding a synaptic vesicle.
	GO:0043195	terminal bouton	Terminal inflated portion of the axon, containing the specialized apparatus necessary to release neurotransmitters. The axon terminus is considered to be the whole region of thickening and the terminal bouton is a specialized region of it.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 2qep)

	Cis Peptide Bonds
		Arg A:935 - Gly A:936	[ RasMol ]
		Glu A:758 - Pro A:759	[ RasMol ]
		Glu B:758 - Pro B:759	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2qep
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PTPR2_HUMAN \| Q92932
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PTPR2_HUMAN \| Q92932
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PTPR2_HUMAN \| Q92932	:	4hti 4htj

2i1y	CRYSTAL STRUCTURE OF THE PHOSPHATASE DOMAIN OF HUMAN PTP IA -2

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 6)

Exons (10, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (25, 25)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File