2PNT - JenaLib

Title :   CRYSTAL STRUCTURE OF THE PDZ DOMAIN OF HUMAN GRASP (GRP1) IN COMPLEX WITH THE C-TERMINAL PEPTIDE OF THE METABOTROPIC GLUTAMATE RECEPTOR TYPE 1

Authors :   J. Elkins, E. Papagrigoriou, C. Cooper, C. Gileadi, J. Uppenberg, J. Bray, F. Von Delft, A. C. W. Pike, E. Ugochukwu, C. Umeano, O. Gileadi, A. Edwards, C. H. Arrowsmith, J. Weigelt, M. Sundstrom, D. A. Doyle, Structural Genomics Consortium (Sgc)

Date :   25 Apr 07 (Deposition) - 08 May 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.15

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Scaffold Protein, Structural Genomics, Structural Genomics Consortium, Sgc, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Elkins, E. Papagrigoriou, C. Cooper, C. Gileadi, J. Uppenberg, J. Bray, F. Von Delft, A. C. W. Pike, E. Ugochukwu, C. Umeano, O. Gileadi, A. Edwards, C. H. Arrowsmith, J. Weigelt, M. Sundstrom, D. A. Doyle, Structural Genomics Consortium (Sgc)
Crystal Structure Of The Pdz Domain Of Human Grasp (Grp1) In Complex With The C-Terminal Peptide Of The Metabotropic Glutamate Receptor Type 1.
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (5, 10)

Asymmetric Unit (5, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000293662	1	ENSE00001328100	chr12:52400724-52401049	326	GRASP_HUMAN	1-82	82	0	-	-
1.2	ENST00000293662	2	ENSE00001060706	chr12:52402974-52403023	50	GRASP_HUMAN	83-99	17	2	A:97-99 B:98-99	3 2
1.3	ENST00000293662	3	ENSE00001060705	chr12:52404665-52404719	55	GRASP_HUMAN	99-117	19	2	A:99-117 B:99-117	19 19
1.4	ENST00000293662	4	ENSE00001060708	chr12:52404823-52404925	103	GRASP_HUMAN	118-152	35	2	A:118-152 (gaps) B:118-152	35 35
1.6	ENST00000293662	6	ENSE00001060701	chr12:52407471-52407564	94	GRASP_HUMAN	152-183	32	2	A:152-183 B:152-183	32 32
1.7	ENST00000293662	7	ENSE00001060700	chr12:52407661-52407727	67	GRASP_HUMAN	183-205	23	2	A:183-192 B:183-192	10 10
1.8	ENST00000293662	8	ENSE00001060698	chr12:52407919-52407985	67	GRASP_HUMAN	206-228	23	0	-	-
1.9	ENST00000293662	9	ENSE00001483521	chr12:52408478-52409648	1171	GRASP_HUMAN	228-395	168	0	-	-

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:90
 aligned with GRASP_HUMAN | Q7Z6J2 from UniProtKB/Swiss-Prot  Length:395

    Alignment length:96
                                   106       116       126       136       146       156       166       176       186      
          GRASP_HUMAN    97 QQRKVLTLEKEDNQTFGFEIQTYGLHHREEQRVEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGTSI 192
               SCOP domains d2pnta_ A: automated match      es                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeee........eeeeeeee.------.eeeeeeeee...hhhhhh......eeeee..ee....hhhhhhhhhhhh..eeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----PDZ  PDB: A:101-188 UniProt: 101-190                                                      -- PROSITE
           Transcript 1 (1) 1.2------------------Exon 1.4  PDB: A:118-152 (gaps)    ------------------------------Exon 1.7   Transcript 1 (1)
           Transcript 1 (2) --Exon 1.3           ----------------------------------Exon 1.6  PDB: A:152-183        --------- Transcript 1 (2)
                 2pnt A  97 QQRKVLTLEKEDNQTFGFEIQTYGLH------VEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYSSTL 192
                                   106       116     |   -  |    136       146       156       166       176       186      
                                                   122    129

Chain B from PDB  Type:PROTEIN  Length:95
 aligned with GRASP_HUMAN | Q7Z6J2 from UniProtKB/Swiss-Prot  Length:395

    Alignment length:95
                                   107       117       127       137       147       157       167       177       187     
          GRASP_HUMAN    98 QRKVLTLEKEDNQTFGFEIQTYGLHHREEQRVEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGTSI 192
               SCOP domains d2pntb_ B: automated matches                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---PDZ-2pntB01 B:101-187                                                                  ----- Pfam domains (1)
           Pfam domains (2) ---PDZ-2pntB02 B:101-187                                                                  ----- Pfam domains (2)
         Sec.struct. author ..eeeeee........eeeeeeee........eeeeeeeee...hhhhhh......eeeee..ee....hhhhhhhhhhhh..eeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---PDZ  PDB: B:101-188 UniProt: 101-190                                                      -- PROSITE
           Transcript 1 (1) 1.------------------Exon 1.4  PDB: B:118-152           ------------------------------Exon 1.7   Transcript 1 (1)
           Transcript 1 (2) -Exon 1.3           ----------------------------------Exon 1.6  PDB: B:152-183        --------- Transcript 1 (2)
                 2pnt B  98 QRKVLTLEKEDNQTFGFEIQTYGLHHREEQRVEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYSSTL 192
                                   107       117       127       137       147       157       167       177       187

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (12, 12)

Asymmetric Unit(hide GO term definitions)

Chain A,B (GRASP_HUMAN | Q7Z6J2)

molecular function
	GO:0030306	ADP-ribosylation factor binding	Interacting selectively and non-covalently with ARF, ADP-ribosylation factor, a small monomeric cytosolic GTPase that, when bound to GTP, binds to the membranes of cells.
	GO:0030165	PDZ domain binding	Interacting selectively and non-covalently with a PDZ domain of a protein, a domain found in diverse signaling proteins.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
biological process
	GO:0008104	protein localization	Any process in which a protein is transported to, or maintained in, a specific location.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0045211	postsynaptic membrane	A specialized area of membrane facing the presynaptic membrane on the tip of the nerve ending and separated from it by a minute cleft (the synaptic cleft). Neurotransmitters cross the synaptic cleft and transmit the signal to the postsynaptic membrane.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pnt)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2pnt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GRASP_HUMAN \| Q7Z6J2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description