2PMT - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   GLUTATHIONE TRANSFERASE FROM PROTEUS MIRABILIS

Authors :   J. Rossjohn, G. Polekhina, S. C. Feil, N. Allocati, M. Masulli, C. Diili M. W. Parker

Date :   28 Apr 98 (Deposition) - 27 Apr 99 (Release) - 18 Jan 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Transferase, Glutathione-Conjugating, A Putative Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Rossjohn, G. Polekhina, S. C. Feil, N. Allocati, M. Masulli, C. De Illio, M. W. Parker
A Mixed Disulfide Bond In Bacterial Glutathione Transferase Functional And Evolutionary Implications.
Structure V. 6 721 1998
PubMed-ID: 9655824 | Reference-DOI: 10.1016/S0969-2126(98)00074-4

Molecule 1 - GLUTATHIONE TRANSFERASE
	Cellular Location	:	PERIPLASM
	Chains	:	A, B, C, D
	EC Number	:	2.5.1.18
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Expression System Vector Type	:	BACTERIAL
	Organism Scientific	:	PROTEUS MIRABILIS
	Organism Taxid	:	584
	Synonym	:	PMGST, GST B1-1

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	GSH	4	Ligand/Ion	GLUTATHIONE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	GSH	2	Ligand/Ion	GLUTATHIONE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	GSH	2	Ligand/Ion	GLUTATHIONE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:9 , CYS A:10 , LYS A:35 , GLY A:50 , GLN A:51 , VAL A:52 , GLU A:65 , GLY A:66 , HIS A:106 , LYS A:107 , ASN B:99 , SER B:103 , GLU B:104	BINDING SITE FOR RESIDUE GSH A 204
2	AC2	SOFTWARE	ASN A:99 , SER A:103 , GLU A:104 , SER B:9 , CYS B:10 , LYS B:35 , GLY B:50 , GLN B:51 , VAL B:52 , GLU B:65 , GLY B:66 , HIS B:106 , LYS B:107	BINDING SITE FOR RESIDUE GSH B 204
3	AC3	SOFTWARE	SER C:9 , CYS C:10 , LYS C:35 , GLY C:50 , GLN C:51 , VAL C:52 , GLU C:65 , GLY C:66 , HIS C:106 , LYS C:107 , ASN D:99 , SER D:103 , GLU D:104	BINDING SITE FOR RESIDUE GSH C 204
4	AC4	SOFTWARE	ASN C:99 , SER C:103 , GLU C:104 , SER D:9 , CYS D:10 , LYS D:35 , GLY D:50 , GLN D:51 , VAL D:52 , GLU D:65 , GLY D:66 , HIS D:106 , LYS D:107	BINDING SITE FOR RESIDUE GSH D 204

(no "SS Bond" information available for 2PMT)

Asymmetric Unit

No.	Residues
1	Val A:52	-	Pro A:53
2	Val B:52	-	Pro B:53
3	Val C:52	-	Pro C:53
4	Val D:52	-	Pro D:53

(no "SAP(SNP)/Variant" information available for 2PMT)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GST_PROMI	1-81	4	A:1-81 B:1-81 C:1-81 D:1-81
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GST_PROMI	87-203	4	A:87-201 B:87-201 C:87-201 D:87-201

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GST_PROMI	1-81	2	A:1-81 B:1-81 - -
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GST_PROMI	87-203	2	A:87-201 B:87-201 - -

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GST_PROMI	1-81	2	- - C:1-81 D:1-81
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GST_PROMI	87-203	2	- - C:87-201 D:87-201

(no "Exon" information available for 2PMT)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:201
 aligned with GST_PROMI | P15214 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200 
            GST_PROMI     1 MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI 201
               SCOP domains d2pmta2 A:1-80 Class beta GST                                                   d2pmta1 A:81-201 Class beta GST                                                                                           SCOP domains
               CATH domains 2pmtA01 A:1-81,A:189-201 Glutaredoxin                                            2pmtA02 A:82-188  [code=1.20.1050.10, no name defined]                                                     2pmtA01       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee....hhhhhhhhhhhh....eeee.............hhh........eee.....eee.hhhhhhhhhhh.hhh........hhhhhhhhhhhhhhh..hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh.hhhh.......hhhhhhhhhhhh.hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: A:1-81 UniProt: 1-81                                              -----GST_CTER  PDB: A:87-201 UniProt: 87-203                                                                             PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pmt A   1 MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI 201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200

Chain B from PDB  Type:PROTEIN  Length:201
 aligned with GST_PROMI | P15214 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200 
            GST_PROMI     1 MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI 201
               SCOP domains d2pmtb2 B:1-80 Class beta GST                                                   d2pmtb1 B:81-201 Class beta GST                                                                                           SCOP domains
               CATH domains 2pmtB01 B:1-81,B:189-201 Glutaredoxin                                            2pmtB02 B:82-188  [code=1.20.1050.10, no name defined]                                                     2pmtB01       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee....hhhhhhhhhhhh....eeee.............hhh........eee.....eee.hhhhhhhhhhh.hhh........hhhhhhhhhhhhhhh..hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh.hhhh.......hhhhhhhhhhhh.hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: B:1-81 UniProt: 1-81                                              -----GST_CTER  PDB: B:87-201 UniProt: 87-203                                                                             PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pmt B   1 MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI 201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200

Chain C from PDB  Type:PROTEIN  Length:201
 aligned with GST_PROMI | P15214 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200 
            GST_PROMI     1 MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI 201
               SCOP domains d2pmtc2 C:1-80 Class beta GST                                                   d2pmtc1 C:81-201 Class beta GST                                                                                           SCOP domains
               CATH domains 2pmtC01 C:1-81,C:189-201 Glutaredoxin                                            2pmtC02 C:82-188  [code=1.20.1050.10, no name defined]                                                     2pmtC01       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee....hhhhhhhhhhhh....eeee.............hhh........eee.....eee.hhhhhhhhhhh.hhh........hhhhhhhhhhhhhhh..hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh.hhhh.......hhhhhhhhhhhh.hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: C:1-81 UniProt: 1-81                                              -----GST_CTER  PDB: C:87-201 UniProt: 87-203                                                                             PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pmt C   1 MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI 201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200

Chain D from PDB  Type:PROTEIN  Length:201
 aligned with GST_PROMI | P15214 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200 
            GST_PROMI     1 MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI 201
               SCOP domains d2pmtd2 D:1-80 Class beta GST                                                   d2pmtd1 D:81-201 Class beta GST                                                                                           SCOP domains
               CATH domains 2pmtD01 D:1-81,D:189-201 Glutaredoxin                                            2pmtD02 D:82-188  [code=1.20.1050.10, no name defined]                                                     2pmtD01       CATH domains
           Pfam domains (1) GST_N-2pmtD05 D:1-75                                                       --------------GST_C-2pmtD01 D:90-189                                                                              ------------ Pfam domains (1)
           Pfam domains (2) GST_N-2pmtD06 D:1-75                                                       --------------GST_C-2pmtD02 D:90-189                                                                              ------------ Pfam domains (2)
           Pfam domains (3) GST_N-2pmtD07 D:1-75                                                       --------------GST_C-2pmtD03 D:90-189                                                                              ------------ Pfam domains (3)
           Pfam domains (4) GST_N-2pmtD08 D:1-75                                                       --------------GST_C-2pmtD04 D:90-189                                                                              ------------ Pfam domains (4)
         Sec.struct. author .eeee....hhhhhhhhhhhh....eeee.............hhh........eee.....eee.hhhhhhhhhhh.hhh........hhhhhhhhhhhhhhh..hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh.hhhh.......hhhhhhhhhhhh.hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: D:1-81 UniProt: 1-81                                              -----GST_CTER  PDB: D:87-201 UniProt: 87-203                                                                             PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pmt D   1 MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI 201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: GST C-terminal domain-like (353)

Superfamily: GST C-terminal domain-like (353)

Family: Glutathione S-transferase (GST), C-terminal domain (263)

Protein domain: Class beta GST (8)

Proteus mirabilis [TaxId: 584] (2)

1a	d2pmta1	A:81-201
1b	d2pmtb1	B:81-201
1c	d2pmtc1	C:81-201
1d	d2pmtd1	D:81-201

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: Glutathione S-transferase (GST), N-terminal domain (216)

Protein domain: Class beta GST (8)

Proteus mirabilis [TaxId: 584] (2)

2a	d2pmta2	A:1-80
2b	d2pmtb2	B:1-80
2c	d2pmtc2	C:1-80
2d	d2pmtd2	D:1-80

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Glutaredoxin (620)

Homologous Superfamily: Glutaredoxin (617)

Proteus mirabilis. Organism_taxid: 584. (2)

1a	2pmtA01	A:1-81,A:189-201
1b	2pmtB01	B:1-81,B:189-201
1c	2pmtC01	C:1-81,C:189-201
1d	2pmtD01	D:1-81,D:189-201

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 (267)

Homologous Superfamily: [code=1.20.1050.10, no name defined] (249)

Proteus mirabilis. Organism_taxid: 584. (2)

2a	2pmtA02	A:82-188
2b	2pmtB02	B:82-188
2c	2pmtC02	C:82-188
2d	2pmtD02	D:82-188

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: GST_C (118)

Family: GST_C (102)

Proteus mirabilis (2)

1a	GST_C-2pmtD01	D:90-189
1b	GST_C-2pmtD02	D:90-189
1c	GST_C-2pmtD03	D:90-189
1d	GST_C-2pmtD04	D:90-189

Clan: Thioredoxin (367)

Family: GST_N (88)

Proteus mirabilis (2)

2a	GST_N-2pmtD05	D:1-75
2b	GST_N-2pmtD06	D:1-75
2c	GST_N-2pmtD07	D:1-75
2d	GST_N-2pmtD08	D:1-75

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (GST_PROMI | P15214)

molecular function
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GSH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Val A:52 - Pro A:53	[ RasMol ]
		Val B:52 - Pro B:53	[ RasMol ]
		Val C:52 - Pro C:53	[ RasMol ]
		Val D:52 - Pro D:53	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2pmt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GST_PROMI \| P15214
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.18
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GST_PROMI \| P15214
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GST_PROMI \| P15214	:	1pmt

(no "Related Entries Specified in the PDB File" available for 2PMT)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 8)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (2, 8)

Gene Ontology (3, 3)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File