|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 10)| Asymmetric/Biological Unit (4, 10) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2PIJ) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PIJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2PIJ) |
Exons (0, 0)| (no "Exon" information available for 2PIJ) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:59 aligned with J3IU59_9PSED | J3IU59 from UniProtKB/TrEMBL Length:67 Alignment length:59 10 20 30 40 50 J3IU59_9PSED 1 MKKIPLSKYLEEHGTQAALAAALGVNQSAISQMVRAGRSIEITLHNDGRIEANEIRPIP 59 SCOP domains d2pija_ A: automated matches SCOP domains CATH domains -2pijA00 A:2-59 lambda repressor-like DNA-binding domains CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------- Transcript 2pij A 1 mKKIPLSKYLEEHGTQSALAAALGVNQSAISQmVRAGRSIEITLYEDGRVEANEIRPIP 59 | 10 20 30 | 40 50 | 33-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:60 aligned with J3IU59_9PSED | J3IU59 from UniProtKB/TrEMBL Length:67 Alignment length:60 10 20 30 40 50 60 J3IU59_9PSED 1 MKKIPLSKYLEEHGTQAALAAALGVNQSAISQMVRAGRSIEITLHNDGRIEANEIRPIPA 60 SCOP domains d2pijb_ B: automated matches SCOP domains CATH domains -2pijB00 B:2-60 lambda repressor-like DNA-binding domains CATH domains Pfam domains ------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------ Transcript 2pij B 1 mKKIPLSKYLEEHGTQSALAAALGVNQSAISQmVRAGRSIEITLYEDGRVEANEIRPIPA 60 | 10 20 30 | 40 50 60 1-MSE 33-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2PIJ) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (J3IU59_9PSED | J3IU59)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|