Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF C-C BOND-FORMING DTDP-D-OLIVOSE-TRANSFERASE URDGT2
 
Authors :  M. Mittler, A. Bechthold, G. E. Schulz
Date :  19 Mar 07  (Deposition) - 07 Aug 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.88
Chains :  Asym./Biol. Unit :  A,B
Keywords :  C-Glycosyltransferase, Dtdp-D-Olivose-Transferase, Polyketide Aglycon, Gt-B Family, X-Ray-Diffraction, Urdamycina-Biosynthesis, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Mittler, A. Bechthold, G. E. Schulz
Structure And Action Of The C-C Bond-Forming Glycosyltransferase Urdgt2 Involved In The Biosynthesis Of The Antibiotic Urdamycin.
J. Mol. Biol. V. 372 67 2007
PubMed-ID: 17640665  |  Reference-DOI: 10.1016/J.JMB.2007.06.005

(-) Compounds

Molecule 1 - GLYCOSYL TRANSFERASE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PRSET
    Expression System Strain: E. COLI BL21 (DE3) PLYSS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: URDGT2
    Organism Scientific: STREPTOMYCES FRADIAE
    Organism Taxid: 1906
    Strain: STREPTOMYCES FRADIAE TUE2717

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 7)

Asymmetric/Biological Unit (1, 7)
No.NameCountTypeFull Name
1GOL7Ligand/IonGLYCEROL

(-) Sites  (0, 0)

(no "Site" information available for 2P6P)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2P6P)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ser B:217 -Gly B:218

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2P6P)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2P6P)

(-) Exons   (0, 0)

(no "Exon" information available for 2P6P)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:382
 aligned with Q9RPA7_STRFR | Q9RPA7 from UniProtKB/TrEMBL  Length:365

    Alignment length:382
                                         1                                                                                                                                                                                                                                                                                                                                                                         365    
                                     -   |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       | -  
         Q9RPA7_STRFR     - -------------MFALAPLATAARNAGHQVVMAANQDMGPVVTGVGLPAVATTDLPIRHFITTDREGRPEAIPSDPVAQARFTGRWFARMAASSLPRMLDFSRAWRPDLIVGGTMSYVAPLLALHLGVPHARQTWDAVDADGIHPGADAELRPELSELGLERLPAPDLFIDICPPSLRPANAAPARMMRHVATSRQCPLEPWMYTRDTRQRVLVTSGSRVAKESYDRNFDFLRGLAKDLVRWDVELIVAAPDTVAEALRAEVPQARVGWTPLDVVAPTCDLLVHHAGGVSTLTGLSAGEPQLLIPKGSVLEAPARRVADYGAAIALLPGEDSTEAIADSCQELHAKDTYARRAQDLSREISGMPLPATVVTALEQLA----   -
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhhhhh..eeeeeehhhhhhhhhhh...eee....hhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhh..eeee.........hhhhhhhhhhhhhhhh.........eeee..hhhhh.......ee............hhhhhh.....eeeee...............hhhhhhhhhhh...eeeee.hhhhhhhhhhhh...eee..hhhhhhhhh.eeee....hhhhhhhhh...eee...hhhhhhhhhhhhhhh.eee......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p6p A   1 MRILFVAAGSPATVFALAPLATAARNAGHQVVMAANQDMGPVVTGVGLPAVATTDLPIRHFITTDREGRPEAIPSDPVAQARFTGRWFARMAASSLPRMLDFSRAWRPDLIVGGTMSYVAPLLALHLGVPHARQTWDAVDADGIHPGADAELRPELSELGLERLPAPDLFIDICPPSLRPANAAPARMMRHVATSRQCPLEPWMYTRDTRQRVLVTSGSRVAKESYDRNFDFLRGLAKDLVRWDVELIVAAPDTVAEALRAEVPQARVGWTPLDVVAPTCDLLVHHAGGVSTLTGLSAGVPQLLIPKGSVLEAPARRVADYGAAIALLPGEDSTEAIADSCQELQAKDTYARRAQDLSREISGMPLPATVVTALEQLAHHHH 382
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380  


Chain B from PDB  Type:PROTEIN  Length:376
 aligned with Q9RPA7_STRFR | Q9RPA7 from UniProtKB/TrEMBL  Length:365

    Alignment length:384
                                         1                                                                                                                                                                                                                                                                                                                                                                         365      
                                     -   |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       | -    
         Q9RPA7_STRFR     - -------------MFALAPLATAARNAGHQVVMAANQDMGPVVTGVGLPAVATTDLPIRHFITTDREGRPEAIPSDPVAQARFTGRWFARMAASSLPRMLDFSRAWRPDLIVGGTMSYVAPLLALHLGVPHARQTWDAVDADGIHPGADAELRPELSELGLERLPAPDLFIDICPPSLRPANAAPARMMRHVATSRQCPLEPWMYTRDTRQRVLVTSGSRVAKESYDRNFDFLRGLAKDLVRWDVELIVAAPDTVAEALRAEVPQARVGWTPLDVVAPTCDLLVHHAGGVSTLTGLSAGEPQLLIPKGSVLEAPARRVADYGAAIALLPGEDSTEAIADSCQELHAKDTYARRAQDLSREISGMPLPATVVTALEQLA------   -
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) --------------Glyco_transf_28-2p6pB03 B:15-146                                                                                                    ------------------------DUF1205-2p6pB01 B:171-267                                                                        --------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) --------------Glyco_transf_28-2p6pB04 B:15-146                                                                                                    ------------------------DUF1205-2p6pB02 B:171-267                                                                        --------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhhhhh..eeeeeehhhhhhhhhh....eee....hhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhh..eeee.........hhhhhhhhhhhhhhhh.........eeee..hhhhh.......ee............hhhhhh.....eeeeee.--------hhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhh...ee...hhhhhhhhh.eeeeee...hhhhhhhhh..eeeee.hhhhhhhhhhhhhhh.eee......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2p6p B   1 MRILFVAAGSPATVFALAPLATAARNAGHQVVMAANQDMGPVVTGVGLPAVATTDLPIRHFITTDREGRPEAIPSDPVAQARFTGRWFARMAASSLPRMLDFSRAWRPDLIVGGTMSYVAPLLALHLGVPHARQTWDAVDADGIHPGADAELRPELSELGLERLPAPDLFIDICPPSLRPANAAPARMMRHVATSRQCPLEPWMYTRDTRQRVLVTSG--------DRNFDFLRGLAKDLVRWDVELIVAAPDTVAEALRAEVPQARVGWTPLDVVAPTCDLLVHHAGGVSTLTGLSAGVPQLLIPKGSVLEAPARRVADYGAAIALLPGEDSTEAIADSCQELQAKDTYARRAQDLSREISGMPLPATVVTALEQLAHHHHHH 384
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       | -      |230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380    
                                                                                                                                                                                                                                                   218      227
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2P6P)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2P6P)

(-) Pfam Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Clan: GT-B (132)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q9RPA7_STRFR | Q9RPA7)
molecular function
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2p6p)
 
  Cis Peptide Bonds
    Ser B:217 - Gly B:218   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2p6p
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9RPA7_STRFR | Q9RPA7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9RPA7_STRFR | Q9RPA7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q9RPA7_STRFR | Q9RPA7: 4rig 4rih 4rii

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2P6P)