2P4U - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF ACID PHOSPHATASE 1 (ACP1) FROM MUS MUSCULUS

Authors :   J. B. Bonanno, J. Freeman, K. T. Bain, B. Wu, W. Xu, D. Smith, S. Wasserman, J. M. Sauder, S. K. Burley, S. C. Almo, New York Sgx Research Center For Structural Genomics (Nysgxrc)

Date :   13 Mar 07 (Deposition) - 20 Mar 07 (Release) - 25 Mar 08 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Structural Genomics, Hydrolase, Psi-2, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. C. Almo, J. B. Bonanno, J. M. Sauder, S. Emtage, T. P. Dilorenzo, V. Malashkevich, S. R. Wasserman, S. Swaminathan, S. Eswaramoorthy, R. Agarwal, D. Kumaran, M. Madegowda, S. Ragumani, Y. Patskovsky, J. Alvarado, U. A. Ramagopal, J. Faber-Barata, M. R. Chance, A. Sali, A. Fiser, Z. Y. Zhang, D. S. Lawrence, S. K. Burley
Structural Genomics Of Protein Phosphatases.
J. Struct. Funct. Genom. V. 8 121 2007
PubMed-ID: 18058037 | Reference-DOI: 10.1007/S10969-007-9036-1
(for further references see the PDB file header)

Molecule 1 - ACID PHOSPHATASE 1
	Chains	:	A, B, C, D
	EC Number	:	3.1.3.2
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	MODIFIED PET26
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector	:	PET
	Expression System Vector Type	:	PLASMID
	Gene	:	ACP1
	Organism Common	:	HOUSE MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Strain	:	FVB/N
	Synonym	:	ACP1 PROTEIN

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	PO4	4	Ligand/Ion	PHOSPHATE ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	PO4	1	Ligand/Ion	PHOSPHATE ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	PO4	1	Ligand/Ion	PHOSPHATE ION

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	PO4	1	Ligand/Ion	PHOSPHATE ION

Biological Unit 4 (1, 1)

No.	Name	Count	Type	Full Name
1	PO4	1	Ligand/Ion	PHOSPHATE ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	CYS A:13 , LEU A:14 , GLY A:15 , ASN A:16 , ILE A:17 , CYS A:18 , ARG A:19 , ASP A:130	BINDING SITE FOR RESIDUE PO4 A 201
2	AC2	SOFTWARE	CYS B:13 , LEU B:14 , GLY B:15 , ASN B:16 , ILE B:17 , CYS B:18 , ARG B:19 , ASP B:130 , HOH B:244	BINDING SITE FOR RESIDUE PO4 B 201
3	AC3	SOFTWARE	CYS C:13 , LEU C:14 , GLY C:15 , ASN C:16 , ILE C:17 , CYS C:18 , ARG C:19 , ASP C:130	BINDING SITE FOR RESIDUE PO4 C 201
4	AC4	SOFTWARE	CYS D:13 , LEU D:14 , GLY D:15 , ASN D:16 , ILE D:17 , CYS D:18 , ARG D:19 , ASP D:130	BINDING SITE FOR RESIDUE PO4 D 201

(no "SS Bond" information available for 2P4U)

(no "Cis Peptide Bond" information available for 2P4U)

Asymmetric Unit (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_PPAC_MOUSE_001 *	L	14	P	PPAC_MOUSE	---	---	A/B/C/D	L	14	P
2	UniProt	VAR_PPAC_MOUSE_002 *	T	157	P	PPAC_MOUSE	---	---	A/B/C/D	T	157	P
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_PPAC_MOUSE_001 *	L	14	P	PPAC_MOUSE	---	---	A	L	14	P
2	UniProt	VAR_PPAC_MOUSE_002 *	T	157	P	PPAC_MOUSE	---	---	A	T	157	P
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_PPAC_MOUSE_001 *	L	14	P	PPAC_MOUSE	---	---	B	L	14	P
2	UniProt	VAR_PPAC_MOUSE_002 *	T	157	P	PPAC_MOUSE	---	---	B	T	157	P
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_PPAC_MOUSE_001 *	L	14	P	PPAC_MOUSE	---	---	C	L	14	P
2	UniProt	VAR_PPAC_MOUSE_002 *	T	157	P	PPAC_MOUSE	---	---	C	T	157	P
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_PPAC_MOUSE_001 *	L	14	P	PPAC_MOUSE	---	---	D	L	14	P
2	UniProt	VAR_PPAC_MOUSE_002 *	T	157	P	PPAC_MOUSE	---	---	D	T	157	P
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2P4U)

(no "Exon" information available for 2P4U)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:153
 aligned with PPAC_MOUSE | Q9D358 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:153
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155   
           PPAC_MOUSE     6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHIARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
               SCOP domains d2p4ua_ A: Tyrosine phosphatase                                                                                                                           SCOP domains
               CATH domains 2p4uA00 A:6-158  [code=3.40.50.270, no name defined]                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....hhhhhhhhhhhhhhhhh.hhh.eeeeeee..........hhhhhhhhhhh...........hhhhhhhh.eeee.hhhhhhhhhhhhhh......eeee.hhhh.............hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------P----------------------------------------------------------------------------------------------------------------------------------------------P- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p4u A   6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155

Chain A from PDB  Type:PROTEIN  Length:153
 aligned with Q561M1_MOUSE | Q561M1 from UniProtKB/TrEMBL  Length:158

    Alignment length:153
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155   
         Q561M1_MOUSE     6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
               SCOP domains d2p4ua_ A: Tyrosine phosphatase                                                                                                                           SCOP domains
               CATH domains 2p4uA00 A:6-158  [code=3.40.50.270, no name defined]                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....hhhhhhhhhhhhhhhhh.hhh.eeeeeee..........hhhhhhhhhhh...........hhhhhhhh.eeee.hhhhhhhhhhhhhh......eeee.hhhh.............hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------P----------------------------------------------------------------------------------------------------------------------------------------------P- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p4u A   6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155

Chain B from PDB  Type:PROTEIN  Length:153
 aligned with PPAC_MOUSE | Q9D358 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:153
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155   
           PPAC_MOUSE     6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHIARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
               SCOP domains d2p4ub_ B: Tyrosine phosphatase                                                                                                                           SCOP domains
               CATH domains 2p4uB00 B:6-158  [code=3.40.50.270, no name defined]                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....hhhhhhhhhhhhhhhhh.hhh.eeeeeee..........hhhhhhhhhhh...........hhhhhhhh.eeee.hhhhhhhhhhhhhh......eeee.hhhh.............hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------P----------------------------------------------------------------------------------------------------------------------------------------------P- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p4u B   6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155

Chain B from PDB  Type:PROTEIN  Length:153
 aligned with Q561M1_MOUSE | Q561M1 from UniProtKB/TrEMBL  Length:158

    Alignment length:153
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155   
         Q561M1_MOUSE     6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
               SCOP domains d2p4ub_ B: Tyrosine phosphatase                                                                                                                           SCOP domains
               CATH domains 2p4uB00 B:6-158  [code=3.40.50.270, no name defined]                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....hhhhhhhhhhhhhhhhh.hhh.eeeeeee..........hhhhhhhhhhh...........hhhhhhhh.eeee.hhhhhhhhhhhhhh......eeee.hhhh.............hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------P----------------------------------------------------------------------------------------------------------------------------------------------P- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p4u B   6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155

Chain C from PDB  Type:PROTEIN  Length:153
 aligned with PPAC_MOUSE | Q9D358 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:153
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155   
           PPAC_MOUSE     6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHIARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
               SCOP domains d2p4uc_ C: Tyrosine phosphatase                                                                                                                           SCOP domains
               CATH domains 2p4uC00 C:6-158  [code=3.40.50.270, no name defined]                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....hhhhhhhhhhhhhhhhh.hhh.eeeeeee..........hhhhhhhhhhh...........hhhhhhhh.eeee.hhhhhhhhhhhhhh......eeee.hhhh.............hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------P----------------------------------------------------------------------------------------------------------------------------------------------P- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p4u C   6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155

Chain C from PDB  Type:PROTEIN  Length:153
 aligned with Q561M1_MOUSE | Q561M1 from UniProtKB/TrEMBL  Length:158

    Alignment length:153
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155   
         Q561M1_MOUSE     6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
               SCOP domains d2p4uc_ C: Tyrosine phosphatase                                                                                                                           SCOP domains
               CATH domains 2p4uC00 C:6-158  [code=3.40.50.270, no name defined]                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....hhhhhhhhhhhhhhhhh.hhh.eeeeeee..........hhhhhhhhhhh...........hhhhhhhh.eeee.hhhhhhhhhhhhhh......eeee.hhhh.............hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------P----------------------------------------------------------------------------------------------------------------------------------------------P- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p4u C   6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155

Chain D from PDB  Type:PROTEIN  Length:153
 aligned with PPAC_MOUSE | Q9D358 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:153
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155   
           PPAC_MOUSE     6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHIARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
               SCOP domains d2p4ud_ D: Tyrosine phosphatase                                                                                                                           SCOP domains
               CATH domains 2p4uD00 D:6-158  [code=3.40.50.270, no name defined]                                                                                                      CATH domains
           Pfam domains (1) ---LMWPc-2p4uD01 D:9-154                                                                                                                             ---- Pfam domains (1)
           Pfam domains (2) ---LMWPc-2p4uD02 D:9-154                                                                                                                             ---- Pfam domains (2)
           Pfam domains (3) ---LMWPc-2p4uD03 D:9-154                                                                                                                             ---- Pfam domains (3)
           Pfam domains (4) ---LMWPc-2p4uD04 D:9-154                                                                                                                             ---- Pfam domains (4)
         Sec.struct. author .eeeeeee....hhhhhhhhhhhhhhhhh.hhh.eeeeeee..........hhhhhhhhhhh...........hhhhhhhh.eeee.hhhhhhhhhhhhhh......eeee.hhhh.............hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------P----------------------------------------------------------------------------------------------------------------------------------------------P- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p4u D   6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155

Chain D from PDB  Type:PROTEIN  Length:153
 aligned with Q561M1_MOUSE | Q561M1 from UniProtKB/TrEMBL  Length:158

    Alignment length:153
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155   
         Q561M1_MOUSE     6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
               SCOP domains d2p4ud_ D: Tyrosine phosphatase                                                                                                                           SCOP domains
               CATH domains 2p4uD00 D:6-158  [code=3.40.50.270, no name defined]                                                                                                      CATH domains
           Pfam domains (1) ---LMWPc-2p4uD01 D:9-154                                                                                                                             ---- Pfam domains (1)
           Pfam domains (2) ---LMWPc-2p4uD02 D:9-154                                                                                                                             ---- Pfam domains (2)
           Pfam domains (3) ---LMWPc-2p4uD03 D:9-154                                                                                                                             ---- Pfam domains (3)
           Pfam domains (4) ---LMWPc-2p4uD04 D:9-154                                                                                                                             ---- Pfam domains (4)
         Sec.struct. author .eeeeeee....hhhhhhhhhhhhhhhhh.hhh.eeeeeee..........hhhhhhhhhhh...........hhhhhhhh.eeee.hhhhhhhhhhhhhh......eeee.hhhh.............hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------P----------------------------------------------------------------------------------------------------------------------------------------------P- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p4u D   6 SKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY 158
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Phosphotyrosine protein phosphatases I-like (60)

Superfamily: Phosphotyrosine protein phosphatases I (50)

Family: Low-molecular-weight phosphotyrosine protein phosphatases (29)

Protein domain: Tyrosine phosphatase (15)

Mouse (Mus musculus) [TaxId: 10090] (1)

1a	d2p4ua_	A:
1b	d2p4ub_	B:
1c	d2p4uc_	C:
1d	d2p4ud_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.270, no name defined] (36)

House mouse (Mus musculus) (1)

1a	2p4uA00	A:6-158
1b	2p4uB00	B:6-158
1c	2p4uC00	C:6-158
1d	2p4uD00	D:6-158

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: LMWPc] (24)

Family: LMWPc (24)

Mus musculus (Mouse) (1)

1a	LMWPc-2p4uD01	D:9-154
1b	LMWPc-2p4uD02	D:9-154
1c	LMWPc-2p4uD03	D:9-154
1d	LMWPc-2p4uD04	D:9-154

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (PPAC_MOUSE | Q9D358)

molecular function
	GO:0003993	acid phosphatase activity	Catalysis of the reaction: an orthophosphoric monoester + H2O = an alcohol + phosphate, with an acid pH optimum.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	Catalysis of the reaction: non-membrane spanning protein tyrosine phosphate + H2O = non-membrane spanning protein tyrosine + phosphate.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0009898	cytoplasmic side of plasma membrane	The leaflet the plasma membrane that faces the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Chain A,B,C,D (Q561M1_MOUSE | Q561M1)

molecular function
	GO:0003993	acid phosphatase activity	Catalysis of the reaction: an orthophosphoric monoester + H2O = an alcohol + phosphate, with an acid pH optimum.
	GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	Catalysis of the reaction: non-membrane spanning protein tyrosine phosphate + H2O = non-membrane spanning protein tyrosine + phosphate.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2p4u)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2p4u
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PPAC_MOUSE \| Q9D358
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q561M1_MOUSE \| Q561M1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PPAC_MOUSE \| Q9D358
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q561M1_MOUSE \| Q561M1
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PPAC_MOUSE \| Q9D358	:	5jnu

(no "Related Entries Specified in the PDB File" available for 2P4U)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (11, 17)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File