Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF SORTASE B FROM B.ANTHRACIS IN COMPLEX WITH AAEK1
 
Authors :  R. Wu, R. Zhang, A. W. Marresso, O. Schneewind, A. Joachimiak
Date :  01 Feb 07  (Deposition) - 19 Jun 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A
Keywords :  Sortaseb Protein, Inhibitor, B. Anthracis, The Great Lakes Regional Center Of Excellence, Glrce, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. W. Maresso, R. Wu, J. W. Kern, R. Zhang, D. Janik, D. M. Missiakas, M. E. Duban, A. Joachimiak, O. Schneewind
Activation Of Inhibitors By Sortase Triggers Irreversible Modification Of The Active Site.
J. Biol. Chem. V. 282 23129 2007
PubMed-ID: 17545669  |  Reference-DOI: 10.1074/JBC.M701857200

(-) Compounds

Molecule 1 - SORTASE B
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PDM68
    Expression System Strain: BL21
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: BA_4783, BAS4438, GBAA4783
    Organism Scientific: BACILLUS ANTHRACIS STR.
    Organism Taxid: 198094
    Strain: AMES
    Synonym: HYPOTHETICAL PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 11)

Asymmetric/Biological Unit (2, 11)
No.NameCountTypeFull Name
1CS31Mod. Amino AcidS-[3-OXO-3-(2-THIENYL)PROPYL]-L-CYSTEINE
2MSE10Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2OQW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OQW)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gly A:242 -Arg A:243

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2OQW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2OQW)

(-) Exons   (0, 0)

(no "Exon" information available for 2OQW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:209
 aligned with Q81L49_BACAN | Q81L49 from UniProtKB/TrEMBL  Length:254

    Alignment length:219
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244         
         Q81L49_BACAN    35 IFMDYYENRKVMAEAQNIYEKSPMEEQSQDGEVRKQFKALQQINQEIVGWITMDDTQINYPIVQAKDNDYYLFRNYKGEDMRAGSIFMDYRNDVKSQNRNTILYGHRMKDGSMFGSLKKMLDEEFFMSHRKLYYDTLFEGYDLEVFSVYTTTTDFYYIETDFSSDTEYTSFLEKIQEKSLYKTDTTVTAGDQIVTLSTCDYALDPEAGRLVVHAKLVKR 253
               SCOP domains d2oqwa_ A: Hypothetical prot   ein BA4783                                                                                                                                                                                   SCOP domains
               CATH domains 2oqwA00 A:35-253  [code=2.40   .260.10, no name defined]                                                                                                                                                                    CATH domains
               Pfam domains ----------------------------   -------------------Sortase-2oqwA01 A:85-251                                                                                                                                               -- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhh......---..hhhhhhhhhhh..eeeeee......eeeee......................eee...........eeeeeee.......hhhhhhhhhhhhhhhh.eeeeee...eeeeeeeeeee..---........hhhhhhhhhhhhhhh..............eeeeeee....----..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2oqw A  35 IFmDYYENRKVmAEAQNIYEKSPmEEQS---EVRKQFKALQQINQEIVGWITmDDTQINYPIVQAKDNDYYLFRNYKGEDmRAGSIFmDYRNDVKSQNRNTILYGHRmKDGSmFGSLKKmLDEEFFmSHRKLYYDTLFEGYDLEVFSVYTTT---YYIETDFSSDTEYTSFLEKIQEKSLYKTDTTVTAGDQIVTLSTcDYAL----GRLVVHAKLVKR 253
                              |     44 |      54   |   | - |      74        84  |     94       104       114|      124       134       144  |    154      |164       174       184 |   | 194       204       214       224       234  |    244         
                              |       46-MSE      58-MSE  66                   87-MSE                     115-MSE  |                 142-MSE|      |      |                      186 190                                        233-CS3  242           
                             37-MSE                                                                              122-MSE                  147-MSE  |      |                                                                                            
                                                                                                                                                 154-MSE  |                                                                                            
                                                                                                                                                        161-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: Sortase] (11)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q81L49_BACAN | Q81L49)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CS3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2oqw)
 
  Cis Peptide Bonds
    Gly A:242 - Arg A:243   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2oqw
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81L49_BACAN | Q81L49
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q81L49_BACAN | Q81L49
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q81L49_BACAN | Q81L49: 1rz2 2oqz

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2OQW)