Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  1.6A CRYSTAL STRUCTURE OF THE PROTEIN BA4783/Q81L49 (SIMILAR TO SORTASE B) FROM BACILLUS ANTHRACIS.
 
Authors :  R. Wu, R. Zhang, P. Gornicki, A. Joachimiak, Midwest Center For Stru Genomics (Mcsg)
Date :  23 Dec 03  (Deposition) - 06 Jul 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A
Keywords :  Sortase B Protein, B. Anthracis, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Zhang, R. Wu, G. Joachimiak, S. K. Mazmanian, D. M. Missiakas, P. Gornicki, O. Schneewind, A. Joachimiak
Structures Of Sortase B From Staphylococcus Aureus And Bacillus Anthracis Reveal Catalytic Amino Acid Triad In The Active Site.
Structure V. 12 1147 2004
PubMed-ID: 15242591  |  Reference-DOI: 10.1016/J.STR.2004.06.001

(-) Compounds

Molecule 1 - CONSERVED HYPOTHETICAL PROTEIN BA4783
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PDM68
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: BA4783
    Organism Scientific: BACILLUS ANTHRACIS
    Organism Taxid: 198094
    Strain: STR. AMES

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1RZ2)

(-) Sites  (0, 0)

(no "Site" information available for 1RZ2)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1RZ2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1RZ2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1RZ2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1RZ2)

(-) Exons   (0, 0)

(no "Exon" information available for 1RZ2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:214
 aligned with Q81L49_BACAN | Q81L49 from UniProtKB/TrEMBL  Length:254

    Alignment length:220
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254
         Q81L49_BACAN    35 IFMDYYENRKVMAEAQNIYEKSPMEEQSQDGEVRKQFKALQQINQEIVGWITMDDTQINYPIVQAKDNDYYLFRNYKGEDMRAGSIFMDYRNDVKSQNRNTILYGHRMKDGSMFGSLKKMLDEEFFMSHRKLYYDTLFEGYDLEVFSVYTTTTDFYYIETDFSSDTEYTSFLEKIQEKSLYKTDTTVTAGDQIVTLSTCDYALDPEAGRLVVHAKLVKRQ 254
               SCOP domains d1rz2a_ A: Hypothetical protein BA4783                                                                                                                                                                                       SCOP domains
               CATH domains 1rz2A00 A:35-254  [code=2.40.260.10, no name defined]                                                                                                                                                                        CATH domains
               Pfam domains --------------------------------------------------Sortase-1rz2A01 A:85-251                                                                                                                                               --- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh.....hhhhh.hhhhhhhhhhh..eeeeee......eeeeee.....................eee...........eeeeee........hhhhhhhhhhhhhhh..eeeeee...eeeeeeeeeee.............hhhhhhhhhhhhhhhh.............eeeeee..------...eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rz2 A  35 IFMDYYENRKVMAEAQNIYEKSPMEEQSQDGEVRKQFKALQQINQEIVGWITMDDTQINYPIVQAKDNDYYLFRNYKGEDMRAGSIFMDYRNDVKSQNRNTILYGHRMKDGSMFGSLKKMLDEEFFMSHRKLYYDTLFEGYDLEVFSVYTTTTDFYYIETDFSSDTEYTSFLEKIQEKSLYKTDTTVTAGDQIVTLSTCD------AGRLVVHAKLVKRQ 254
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234      |244       254
                                                                                                                                                                                                                                 234    241
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: Sortase] (11)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q81L49_BACAN | Q81L49)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1rz2)
 
  Sites
(no "Sites" information available for 1rz2)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1rz2)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1rz2
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81L49_BACAN | Q81L49
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q81L49_BACAN | Q81L49
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q81L49_BACAN | Q81L49: 2oqw 2oqz

(-) Related Entries Specified in the PDB File

1ng5 RELATED ID: APC2100 RELATED DB: TARGETDB