2OQ1 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   TANDEM SH2 DOMAINS OF ZAP-70 WITH 19-MER ZETA1 PEPTIDE

Authors :   M. H. Hatada, E. R. Laird, J. Green, J. Morgenstern, M. K. Ram

Date :   30 Jan 07 (Deposition) - 06 Mar 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B

Keywords :   Tandem Sh2 Domains, Zap-70, Tyrosine Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. H. Hatada, X. Lu, E. R. Laird, J. Green, J. P. Morgenstern, M. Lou, C. Marr, T. B. Phillips, M. K. Ram, K. Theriault
Molecular Basis For The Interaction Of Zap-70 With The T-Cell Receptor
Nature V. 377 32 1995
PubMed-ID: 7659156 | Reference-DOI: 10.1038/377032A0
(for further references see the PDB file header)

Molecule 1 - TYROSINE-PROTEIN KINASE ZAP-70
	Chains	:	A
	EC Number	:	2.7.10.2
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	RESIDUES 3-256
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	70 KDA ZETA-ASSOCIATED PROTEIN, SYK-RELATED TYROSINE KINASE

Molecule 2 - T-CELL SURFACE GLYCOPROTEIN CD3 ZETA CHAIN
	Chains	:	B
	Engineered	:	YES
	Fragment	:	RESIDUES 69-87
	Other Details	:	THIS SEQUENCE OCCURS NATURALLY IN HOMO SAPIENS (HUMANS)
	Synonym	:	T-CELL RECEPTOR T3 ZETA CHAIN, CD247 ANTIGEN
	Synthetic	:	YES

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 6)

No.	Name	Count	Type	Full Name
1	MSE	3	Mod. Amino Acid	SELENOMETHIONINE
2	PB	1	Ligand/Ion	LEAD (II) ION
3	PTR	2	Mod. Amino Acid	O-PHOSPHOTYROSINE

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	CYS A:119	BINDING SITE FOR RESIDUE PB A 1119

(no "SS Bond" information available for 2OQ1)

(no "Cis Peptide Bond" information available for 2OQ1)

Asymmetric/Biological Unit (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_041846	R	175	L	ZAP70_HUMAN	Polymorphism	55964305	A	R	177	L
2	UniProt	VAR_041847	P	191	L	ZAP70_HUMAN	Polymorphism	56403250	A	P	193	L
3	UniProt	VAR_077137	R	192	W	ZAP70_HUMAN	Disease (ADMIO2)	199840952	A	R	194	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH2	PS50001	Src homology 2 (SH2) domain profile.	ZAP70_HUMAN	10-102 163-254	2	A:12-104 A:165-256

Asymmetric/Biological Unit (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000264972	1a	ENSE00001915964	chr2:98330023-98330137	115	ZAP70_HUMAN	-	0	0	-	-
1.2	ENST00000264972	2	ENSE00001346286	chr2:98330379-98330457	79	ZAP70_HUMAN	-	0	0	-	-
1.3	ENST00000264972	3	ENSE00002151593	chr2:98340479-98340901	423	ZAP70_HUMAN	1-134	134	1	A:5-136	132
1.6	ENST00000264972	6	ENSE00001726390	chr2:98341555-98341715	161	ZAP70_HUMAN	135-188	54	1	A:137-190	54
1.7b	ENST00000264972	7b	ENSE00001702700	chr2:98349346-98349484	139	ZAP70_HUMAN	188-234	47	1	A:190-236	47
1.8	ENST00000264972	8	ENSE00001779223	chr2:98349588-98349675	88	ZAP70_HUMAN	235-264	30	1	A:237-258	22
1.9a	ENST00000264972	9a	ENSE00001597048	chr2:98349760-98349806	47	ZAP70_HUMAN	264-279	16	0	-	-
1.9e	ENST00000264972	9e	ENSE00001789090	chr2:98350007-98350058	52	ZAP70_HUMAN	280-297	18	0	-	-
1.9g	ENST00000264972	9g	ENSE00001695806	chr2:98350983-98351175	193	ZAP70_HUMAN	297-361	65	0	-	-
1.9i	ENST00000264972	9i	ENSE00001072211	chr2:98351713-98351919	207	ZAP70_HUMAN	361-430	70	0	-	-
1.10	ENST00000264972	10	ENSE00001038176	chr2:98353936-98354128	193	ZAP70_HUMAN	430-494	65	0	-	-
1.11a	ENST00000264972	11a	ENSE00001506092	chr2:98354220-98354360	141	ZAP70_HUMAN	495-541	47	0	-	-
1.11d	ENST00000264972	11d	ENSE00001038187	chr2:98354458-98354570	113	ZAP70_HUMAN	542-579	38	0	-	-
1.12c	ENST00000264972	12c	ENSE00001267184	chr2:98355838-98356323	486	ZAP70_HUMAN	579-619	41	0	-	-

2.1b	ENST00000362089	1b	ENSE00001897306	chr1:167487775-167487645	131	CD3Z_HUMAN	1-20	20	0	-	-
2.2a	ENST00000362089	2a	ENSE00001164461	chr1:167410004-167409901	104	CD3Z_HUMAN	20-54	35	0	-	-
2.3c	ENST00000362089	3c	ENSE00000958523	chr1:167408637-167408581	57	CD3Z_HUMAN	55-73	19	1	B:301-305	5
2.4	ENST00000362089	4	ENSE00000958524	chr1:167407887-167407807	81	CD3Z_HUMAN	74-100	27	1	B:306-319	14
2.5a	ENST00000362089	5a	ENSE00001067430	chr1:167404671-167404636	36	CD3Z_HUMAN	101-112	12	0	-	-
2.5d	ENST00000362089	5d	ENSE00000958526	chr1:167403313-167403257	57	CD3Z_HUMAN	113-131	19	0	-	-
2.6	ENST00000362089	6	ENSE00000958527	chr1:167402296-167402261	36	CD3Z_HUMAN	132-143	12	0	-	-
2.7d	ENST00000362089	7d	ENSE00001924110	chr1:167400983-167399877	1107	CD3Z_HUMAN	144-164	21	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:254
 aligned with ZAP70_HUMAN | P43403 from UniProtKB/Swiss-Prot  Length:619

    Alignment length:254
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252    
          ZAP70_HUMAN     3 DPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPN 256
               SCOP domains d2oq1a1 A:5-134 Tyrosine-protein kinase zap-70                                                                                    d2oq1a2 A:135-258 Tyrosine-protein kinase zap-70                                                                             SCOP domains
               CATH domains 2oq1A01 A:5-113 SHC Adaptor Protein                                                                          2oq1A02 A:114-158                            2oq1A03 A:159-258 SHC Adaptor Protein                                                                CATH domains
           Pfam domains (1) ----------------------------------------------------------------------------------------------------------------------------------------------------------------SH2-2oq1A01 A:165-241                                                        ----------------- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------SH2-2oq1A02 A:165-241                                                        ----------------- Pfam domains (2)
         Sec.struct. author .............hhhhhhhhhhhh......eeeee.......eeeeeee..eeeeeeeee.....eee.......hhhhhhhhhhhh......................hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh......eeeeee.....eeeeeeee..eeeeeeeee.....ee........hhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------L---------------LW---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------SH2  PDB: A:12-104 UniProt: 10-102                                                           ------------------------------------------------------------SH2  PDB: A:165-256 UniProt: 163-254                                                        -- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:5-136 UniProt: 1-134 [INCOMPLETE]                                                                                  Exon 1.6  PDB: A:137-190 UniProt: 135-188             ----------------------------------------------Exon 1.8 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.7b  PDB: A:190-236 UniProt: 188-234     ---------------------- Transcript 1 (2)
                 2oq1 A   5 DPAAHLPFFYGSISRAEAEEHLKLAGmADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAmVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERmPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPN 258
                                    14        24      | 34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254    
                                                     31-MSE                                                                                      124-MSE                                163-MSE

Chain B from PDB  Type:PROTEIN  Length:19
 aligned with CD3Z_HUMAN | P20963 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:19
                                    78         
           CD3Z_HUMAN    69 NQLYNELNLGRREEYDVLD  87
               SCOP domains ------------------- SCOP domains
               CATH domains ------------------- CATH domains
               Pfam domains ------------------- Pfam domains
         Sec.struct. author .......hhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------- SAPs(SNPs)
                    PROSITE ------------------- PROSITE
               Transcript 2 2.3c Exon 2.4       Transcript 2
                 2oq1 B 301 NQLyNELNLGRREEyDVLD 319
                               |   310    |    
                               |        315-PTR
                             304-PTR

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: SH2-like (260)

Superfamily: SH2 domain (260)

Family: SH2 domain (225)

Protein domain: Tyrosine-protein kinase zap-70 (2)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d2oq1a1	A:5-134
1b	d2oq1a2	A:135-258

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: SHC Adaptor Protein (206)

Homologous Superfamily: SHC Adaptor Protein (206)

Human (Homo sapiens) (147)

1a	2oq1A03	A:159-258
1b	2oq1A01	A:5-113

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Syk Kinase; Chain A, domain 2 (4)

Homologous Superfamily: Syk Kinase; Chain A, domain 2 (4)

Human (Homo sapiens) (4)

2oq1A02

A:114-158

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: SH2] (119)

Family: SH2 (119)

Homo sapiens (Human) (79)

1a	SH2-2oq1A01	A:165-241
1b	SH2-2oq1A02	A:165-241

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (ZAP70_HUMAN | P43403)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0004715	non-membrane spanning protein tyrosine kinase activity	Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0001784	phosphotyrosine residue binding	Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004713	protein tyrosine kinase activity	Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0042113	B cell activation	The change in morphology and behavior of a mature or immature B cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0050853	B cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
	GO:0042110	T cell activation	The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0070489	T cell aggregation	The adhesion of one T cell to one or more other T cells via adhesion molecules.
	GO:0030217	T cell differentiation	The process in which a precursor cell type acquires characteristics of a more mature T-cell. A T cell is a type of lymphocyte whose definin characteristic is the expression of a T cell receptor complex.
	GO:0072678	T cell migration	The movement of a T cell within or between different tissues and organs of the body.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0002250	adaptive immune response	An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
	GO:0043366	beta selection	The process in which successful recombination of a T cell receptor beta chain into a translatable protein coding sequence leads to rescue from apoptosis and subsequent proliferation of an immature T cell.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
	GO:0002281	macrophage activation involved in immune response	A change in morphology and behavior of a macrophage resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor, leading to the initiation or perpetuation of an immune response.
	GO:0045060	negative thymic T cell selection	The process of elimination of immature T cells in the thymus which react strongly with self-antigens.
	GO:0002283	neutrophil activation involved in immune response	The change in morphology and behavior of a neutrophil resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor, leading to the initiation or perpetuation of an immune response.
	GO:0038083	peptidyl-tyrosine autophosphorylation	The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein.
	GO:0018108	peptidyl-tyrosine phosphorylation	The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0045579	positive regulation of B cell differentiation	Any process that activates or increases the frequency, rate or extent of B cell differentiation.
	GO:0045582	positive regulation of T cell differentiation	Any process that activates or increases the frequency, rate or extent of T cell differentiation.
	GO:0046638	positive regulation of alpha-beta T cell differentiation	Any process that activates or increases the frequency, rate or extent of alpha-beta T cell differentiation.
	GO:0046641	positive regulation of alpha-beta T cell proliferation	Any process that activates or increases the frequency, rate or extent of alpha-beta T cell proliferation.
	GO:0050850	positive regulation of calcium-mediated signaling	Any process that activates or increases the frequency, rate or extent of calcium-mediated signaling.
	GO:0033630	positive regulation of cell adhesion mediated by integrin	Any process that activates or increases the frequency, rate, or extent of cell adhesion mediated by integrin.
	GO:0043306	positive regulation of mast cell degranulation	Any process that activates or increases the frequency, rate or extent of mast cell degranulation.
	GO:0045059	positive thymic T cell selection	The process of sparing immature T cells in the thymus which react with self-MHC protein complexes with low affinity levels from apoptotic death.
	GO:0046777	protein autophosphorylation	The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0090330	regulation of platelet aggregation	Any process that modulates the rate, frequency or extent of platelet aggregation. Platelet aggregation is the adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0045061	thymic T cell selection	The process of T cell selection that occurs in the thymus.
	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0042101	T cell receptor complex	A protein complex that contains a disulfide-linked heterodimer of T cell receptor (TCR) chains, which are members of the immunoglobulin superfamily, and mediates antigen recognition, ultimately resulting in T cell activation. The TCR heterodimer is associated with the CD3 complex, which consists of the nonpolymorphic polypeptides gamma, delta, epsilon, zeta, and, in some cases, eta (an RNA splice variant of zeta) or Fc epsilon chains.
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
	GO:0001772	immunological synapse	An area of close contact between a lymphocyte (T-, B-, or natural killer cell) and a target cell formed through the clustering of particular signaling and adhesion molecules and their associated membrane rafts on both the lymphocyte and the target cell and facilitating activation of the lymphocyte, transfer of membrane from the target cell to the lymphocyte, and in some situations killing of the target cell through release of secretory granules and/or death-pathway ligand-receptor interaction.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B (CD3Z_HUMAN | P20963)

molecular function
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004888	transmembrane signaling receptor activity	Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
	GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0050690	regulation of defense response to virus by virus	Any viral process that modulates the frequency, rate, or extent of the antiviral response of the host cell or organism.
	GO:0050776	regulation of immune response	Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0042101	T cell receptor complex	A protein complex that contains a disulfide-linked heterodimer of T cell receptor (TCR) chains, which are members of the immunoglobulin superfamily, and mediates antigen recognition, ultimately resulting in T cell activation. The TCR heterodimer is associated with the CD3 complex, which consists of the nonpolymorphic polypeptides gamma, delta, epsilon, zeta, and, in some cases, eta (an RNA splice variant of zeta) or Fc epsilon chains.
	GO:0042105	alpha-beta T cell receptor complex	A T cell receptor complex in which the TCR heterodimer comprises alpha and beta chains, associated with the CD3 complex; recognizes a complex consisting of an antigen-derived peptide bound to a class I or class II MHC protein.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PB	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PTR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2oq1)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2oq1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CD3Z_HUMAN \| P20963
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	ZAP70_HUMAN \| P43403
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.10.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	617006
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CD3Z_HUMAN \| P20963
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	ZAP70_HUMAN \| P43403
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 2OQ1)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 6)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (1, 2)

Exons (6, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (2, 3)

Pfam Domains (1, 2)

Gene Ontology (63, 69)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File