Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF ZETA-ZETA TRANSMEMBRANE DIMER
 
Authors :  J. J. Chou, K. W. Wucherpfennig, J. R. Schnell, M. E. Call
Date :  12 Jun 06  (Deposition) - 31 Oct 06  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (15x)
Keywords :  Transmembrane, Alpha Helix, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. E. Call, J. R. Schnell, C. Xu, R. A. Lutz, J. J. Chou, K. W. Wucherpfennig
The Structure Of The Zetazeta Transmembrane Dimer Reveals Features Essential For Its Assembly With The T Cell Receptor.
Cell(Cambridge, Mass. ) V. 127 355 2006
PubMed-ID: 17055436  |  Reference-DOI: 10.1016/J.CELL.2006.08.044
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - T-CELL SURFACE GLYCOPROTEIN CD3 ZETA CHAIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentTRANSMEMBRANE REGION (28-60)
    GeneCD3Z, T3Z, TCRZ
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymT-CELL RECEPTOR T3 ZETA CHAIN

 Structural Features

(-) Chains, Units

  
NMR Structure (15x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2HAC)

(-) Sites  (0, 0)

(no "Site" information available for 2HAC)

(-) SS Bonds  (1, 1)

NMR Structure
No.Residues
1A:2 -B:2

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2HAC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2HAC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2HAC)

(-) Exons   (2, 4)

NMR Structure (2, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003620891bENSE00001897306chr1:167487775-167487645131CD3Z_HUMAN1-20200--
1.2aENST000003620892aENSE00001164461chr1:167410004-167409901104CD3Z_HUMAN20-54352A:-3-24
B:-3-24
27
27
1.3cENST000003620893cENSE00000958523chr1:167408637-16740858157CD3Z_HUMAN55-73192A:25-30
B:25-30
6
6
1.4ENST000003620894ENSE00000958524chr1:167407887-16740780781CD3Z_HUMAN74-100270--
1.5aENST000003620895aENSE00001067430chr1:167404671-16740463636CD3Z_HUMAN101-112120--
1.5dENST000003620895dENSE00000958526chr1:167403313-16740325757CD3Z_HUMAN113-131190--
1.6ENST000003620896ENSE00000958527chr1:167402296-16740226136CD3Z_HUMAN132-143120--
1.7dENST000003620897dENSE00001924110chr1:167400983-1673998771107CD3Z_HUMAN144-164210--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:33
 aligned with CD3Z_HUMAN | P20963 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:33
                                    37        47        57   
            CD3Z_HUMAN   28 DPKLCYLLDGILFIYGVILTALFLRVKFSRSAD 60
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
               Transcript 1 Exon 1.2a  PDB: A:-3-24    1.3c   Transcript 1
                  2hac A -3 DSKLCYLLDGILFIYGVILTALFLRVKFSRSAD 30
                              ||     7        17        27   
                             -1|                             
                               1                             

Chain B from PDB  Type:PROTEIN  Length:33
 aligned with CD3Z_HUMAN | P20963 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:33
                                    37        47        57   
            CD3Z_HUMAN   28 DPKLCYLLDGILFIYGVILTALFLRVKFSRSAD 60
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
               Transcript 1 Exon 1.2a  PDB: B:-3-24    1.3c   Transcript 1
                  2hac B -3 DSKLCYLLDGILFIYGVILTALFLRVKFSRSAD 30
                              ||     7        17        27   
                             -1|                             
                               1                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2HAC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2HAC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2HAC)

(-) Gene Ontology  (17, 17)

NMR Structure(hide GO term definitions)
Chain A,B   (CD3Z_HUMAN | P20963)
molecular function
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0004888    transmembrane signaling receptor activity    Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
    GO:0038096    Fc-gamma receptor signaling pathway involved in phagocytosis    An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
    GO:0031295    T cell costimulation    The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
    GO:0050852    T cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0050690    regulation of defense response to virus by virus    Any viral process that modulates the frequency, rate, or extent of the antiviral response of the host cell or organism.
    GO:0050776    regulation of immune response    Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0042101    T cell receptor complex    A protein complex that contains a disulfide-linked heterodimer of T cell receptor (TCR) chains, which are members of the immunoglobulin superfamily, and mediates antigen recognition, ultimately resulting in T cell activation. The TCR heterodimer is associated with the CD3 complex, which consists of the nonpolymorphic polypeptides gamma, delta, epsilon, zeta, and, in some cases, eta (an RNA splice variant of zeta) or Fc epsilon chains.
    GO:0042105    alpha-beta T cell receptor complex    A T cell receptor complex in which the TCR heterodimer comprises alpha and beta chains, associated with the CD3 complex; recognizes a complex consisting of an antigen-derived peptide bound to a class I or class II MHC protein.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2hac)
 
  Sites
(no "Sites" information available for 2hac)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2hac)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2hac
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CD3Z_HUMAN | P20963
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CD3Z_HUMAN | P20963
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CD3Z_HUMAN | P209631tce 1ygr 2oq1 3ik5 3ioz 4xz1

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2HAC)